Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FFF0

Protein Details
Accession C5FFF0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
144-167LIVHQKKEGAPPPKKSKKKGAAAEHydrophilic
NLS Segment(s)
PositionSequence
149-165KKEGAPPPKKSKKKGAA
Subcellular Location(s) cyto 12, cyto_nucl 10.833, cyto_mito 8.833, nucl 8.5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MATLTKVDSAIAGLPSPAEAKKTSKKESTNKNPDVMNIKDLEGLGIELQIAPETQKLNWKLNTSPASLEDKEVLKKFLTTPPVKRIDLQFPLGLEVTARNLKGVTIKDSLDAIYKQFKKKADDELDNPILAGFEWDKEESWTRLIVHQKKEGAPPPKKSKKKGAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.11
5 0.11
6 0.13
7 0.2
8 0.3
9 0.38
10 0.44
11 0.5
12 0.58
13 0.65
14 0.74
15 0.78
16 0.8
17 0.76
18 0.73
19 0.65
20 0.6
21 0.58
22 0.49
23 0.4
24 0.31
25 0.27
26 0.24
27 0.23
28 0.19
29 0.13
30 0.11
31 0.08
32 0.06
33 0.06
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.06
40 0.07
41 0.08
42 0.15
43 0.19
44 0.24
45 0.27
46 0.29
47 0.29
48 0.35
49 0.38
50 0.32
51 0.29
52 0.26
53 0.29
54 0.27
55 0.26
56 0.21
57 0.2
58 0.22
59 0.22
60 0.2
61 0.15
62 0.15
63 0.16
64 0.18
65 0.24
66 0.25
67 0.28
68 0.34
69 0.39
70 0.39
71 0.39
72 0.38
73 0.36
74 0.35
75 0.33
76 0.26
77 0.21
78 0.21
79 0.2
80 0.16
81 0.1
82 0.08
83 0.08
84 0.1
85 0.09
86 0.08
87 0.08
88 0.09
89 0.13
90 0.14
91 0.15
92 0.15
93 0.16
94 0.16
95 0.17
96 0.17
97 0.16
98 0.15
99 0.13
100 0.2
101 0.24
102 0.27
103 0.31
104 0.35
105 0.38
106 0.41
107 0.49
108 0.48
109 0.5
110 0.49
111 0.53
112 0.51
113 0.45
114 0.41
115 0.31
116 0.23
117 0.17
118 0.16
119 0.08
120 0.07
121 0.1
122 0.11
123 0.11
124 0.14
125 0.18
126 0.18
127 0.19
128 0.2
129 0.19
130 0.24
131 0.34
132 0.38
133 0.41
134 0.46
135 0.49
136 0.51
137 0.57
138 0.6
139 0.6
140 0.61
141 0.65
142 0.7
143 0.76
144 0.82
145 0.82
146 0.85
147 0.84