Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0X4C5

Protein Details
Accession A0A4U0X4C5   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPSPDPKPRSQSRSPPRHRDRDNSIQSKKHydrophilic
NLS Segment(s)
PositionSequence
11-101QSRSPPRHRDRDNSIQSKKPASNGSGFRWKEKRRGDGYDGEGRAGSRLERGYRGDVGRERERERERERERERERSPRRDRDRADRARSDRD
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR000048  IQ_motif_EF-hand-BS  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0015629  C:actin cytoskeleton  
GO:0006996  P:organelle organization  
GO:0036211  P:protein modification process  
PROSITE View protein in PROSITE  
PS50096  IQ  
Amino Acid Sequences MPSPDPKPRSQSRSPPRHRDRDNSIQSKKPASNGSGFRWKEKRRGDGYDGEGRAGSRLERGYRGDVGRERERERERERERERERSPRRDRDRADRARSDRDRTDSHREGETSRPARRVPFASSSKRAASNTDATPTTHRAAAPKPAAPPPSTEPMILVHVNDRLGTRATIPCLASDPIKLFKAQVAAKIGRQPHEILLKRQGERPFKDVLTLEDYGVSSGVQLDLELDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.9
5 0.88
6 0.86
7 0.84
8 0.84
9 0.84
10 0.83
11 0.79
12 0.76
13 0.73
14 0.72
15 0.65
16 0.59
17 0.53
18 0.47
19 0.49
20 0.46
21 0.49
22 0.51
23 0.51
24 0.53
25 0.58
26 0.59
27 0.6
28 0.63
29 0.65
30 0.62
31 0.68
32 0.65
33 0.63
34 0.64
35 0.63
36 0.56
37 0.47
38 0.41
39 0.33
40 0.29
41 0.22
42 0.16
43 0.11
44 0.14
45 0.15
46 0.18
47 0.2
48 0.23
49 0.27
50 0.28
51 0.29
52 0.31
53 0.36
54 0.39
55 0.42
56 0.41
57 0.45
58 0.49
59 0.52
60 0.54
61 0.57
62 0.57
63 0.62
64 0.65
65 0.67
66 0.69
67 0.7
68 0.7
69 0.71
70 0.73
71 0.74
72 0.77
73 0.77
74 0.8
75 0.79
76 0.78
77 0.77
78 0.79
79 0.77
80 0.75
81 0.72
82 0.68
83 0.69
84 0.69
85 0.64
86 0.57
87 0.52
88 0.49
89 0.47
90 0.52
91 0.45
92 0.43
93 0.4
94 0.37
95 0.34
96 0.34
97 0.36
98 0.32
99 0.31
100 0.31
101 0.3
102 0.31
103 0.32
104 0.3
105 0.26
106 0.28
107 0.32
108 0.35
109 0.38
110 0.39
111 0.38
112 0.38
113 0.35
114 0.29
115 0.27
116 0.26
117 0.23
118 0.23
119 0.22
120 0.2
121 0.23
122 0.24
123 0.21
124 0.18
125 0.17
126 0.17
127 0.18
128 0.25
129 0.25
130 0.24
131 0.26
132 0.29
133 0.31
134 0.29
135 0.31
136 0.27
137 0.3
138 0.29
139 0.26
140 0.22
141 0.21
142 0.24
143 0.2
144 0.17
145 0.13
146 0.13
147 0.13
148 0.13
149 0.12
150 0.1
151 0.11
152 0.11
153 0.13
154 0.13
155 0.15
156 0.18
157 0.18
158 0.17
159 0.18
160 0.19
161 0.17
162 0.17
163 0.18
164 0.18
165 0.19
166 0.19
167 0.17
168 0.18
169 0.23
170 0.23
171 0.25
172 0.27
173 0.28
174 0.31
175 0.36
176 0.37
177 0.34
178 0.35
179 0.32
180 0.31
181 0.39
182 0.4
183 0.39
184 0.45
185 0.49
186 0.49
187 0.53
188 0.56
189 0.56
190 0.57
191 0.55
192 0.51
193 0.44
194 0.47
195 0.41
196 0.37
197 0.34
198 0.3
199 0.27
200 0.23
201 0.23
202 0.19
203 0.18
204 0.14
205 0.08
206 0.08
207 0.08
208 0.06
209 0.06
210 0.06
211 0.06