Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0XNV8

Protein Details
Accession A0A4U0XNV8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-125DGMPTYTQKYKRQRRKIPRLDTRPYVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024661  RNA_pol_III_Rpc31  
Gene Ontology GO:0005666  C:RNA polymerase III complex  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF11705  RNA_pol_3_Rpc31  
Amino Acid Sequences MSRGGGFGRGRGGGFGKGKMGGIDLPWEYDPDLKVDTKPSELFPKLEPPLAAPPRRLERAQVARYRTLRDRIHEGPLYTVLGHNVRVGKTGGRTQVDPFDGMPTYTQKYKRQRRKIPRLDTRPYVMEFFPEELRSTLDPNYRPSNGTTTSSGSATDNKKKRLLISQGNKLGVLDEFDEENEGRAGEDDDDDAEKDDDEEPAEEEQDDDFEEDEEEGDDYNAEQYFSNGEETEEGGDMGDGGDDYANDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.24
4 0.24
5 0.24
6 0.22
7 0.21
8 0.15
9 0.13
10 0.16
11 0.14
12 0.16
13 0.16
14 0.16
15 0.16
16 0.17
17 0.17
18 0.15
19 0.18
20 0.16
21 0.18
22 0.22
23 0.24
24 0.25
25 0.26
26 0.27
27 0.32
28 0.33
29 0.34
30 0.3
31 0.36
32 0.34
33 0.35
34 0.32
35 0.28
36 0.36
37 0.41
38 0.42
39 0.36
40 0.4
41 0.44
42 0.48
43 0.45
44 0.39
45 0.41
46 0.48
47 0.54
48 0.54
49 0.51
50 0.54
51 0.56
52 0.58
53 0.53
54 0.52
55 0.47
56 0.45
57 0.48
58 0.44
59 0.48
60 0.45
61 0.41
62 0.34
63 0.31
64 0.28
65 0.21
66 0.18
67 0.14
68 0.12
69 0.12
70 0.12
71 0.13
72 0.13
73 0.14
74 0.15
75 0.14
76 0.16
77 0.19
78 0.22
79 0.21
80 0.22
81 0.22
82 0.26
83 0.25
84 0.23
85 0.19
86 0.16
87 0.15
88 0.14
89 0.13
90 0.11
91 0.13
92 0.17
93 0.21
94 0.28
95 0.38
96 0.49
97 0.59
98 0.67
99 0.76
100 0.82
101 0.89
102 0.91
103 0.91
104 0.91
105 0.89
106 0.84
107 0.76
108 0.68
109 0.58
110 0.49
111 0.4
112 0.29
113 0.22
114 0.17
115 0.16
116 0.14
117 0.12
118 0.11
119 0.1
120 0.12
121 0.11
122 0.12
123 0.13
124 0.17
125 0.18
126 0.21
127 0.25
128 0.24
129 0.24
130 0.24
131 0.25
132 0.23
133 0.24
134 0.22
135 0.21
136 0.21
137 0.2
138 0.19
139 0.16
140 0.2
141 0.23
142 0.3
143 0.34
144 0.36
145 0.4
146 0.4
147 0.42
148 0.44
149 0.47
150 0.48
151 0.5
152 0.56
153 0.57
154 0.56
155 0.54
156 0.45
157 0.38
158 0.27
159 0.2
160 0.12
161 0.08
162 0.08
163 0.08
164 0.1
165 0.09
166 0.1
167 0.09
168 0.08
169 0.07
170 0.07
171 0.08
172 0.07
173 0.08
174 0.07
175 0.08
176 0.09
177 0.09
178 0.1
179 0.09
180 0.09
181 0.09
182 0.1
183 0.09
184 0.09
185 0.1
186 0.1
187 0.1
188 0.11
189 0.09
190 0.1
191 0.09
192 0.09
193 0.09
194 0.08
195 0.07
196 0.07
197 0.08
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.06
205 0.06
206 0.08
207 0.08
208 0.08
209 0.08
210 0.08
211 0.1
212 0.11
213 0.13
214 0.11
215 0.11
216 0.11
217 0.12
218 0.13
219 0.12
220 0.11
221 0.09
222 0.08
223 0.08
224 0.07
225 0.06
226 0.04
227 0.04
228 0.05