Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0WAN0

Protein Details
Accession A0A4U0WAN0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-82AYRDCKKQWMTERKEAKRKAGKSHydrophilic
NLS Segment(s)
PositionSequence
75-79AKRKA
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences LSIEMAEQGATPWDKRAETRFDSKKNSEYFDPCQDAADRSIRCLRRNGGDREMCTDYFQAYRDCKKQWMTERKEAKRKAGKSFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.26
4 0.3
5 0.33
6 0.43
7 0.48
8 0.52
9 0.58
10 0.59
11 0.6
12 0.56
13 0.55
14 0.49
15 0.46
16 0.44
17 0.43
18 0.42
19 0.35
20 0.34
21 0.3
22 0.27
23 0.24
24 0.25
25 0.19
26 0.18
27 0.25
28 0.26
29 0.27
30 0.3
31 0.29
32 0.31
33 0.38
34 0.41
35 0.42
36 0.43
37 0.43
38 0.44
39 0.45
40 0.38
41 0.32
42 0.28
43 0.21
44 0.18
45 0.19
46 0.18
47 0.2
48 0.26
49 0.29
50 0.31
51 0.35
52 0.39
53 0.46
54 0.52
55 0.59
56 0.61
57 0.66
58 0.75
59 0.79
60 0.85
61 0.81
62 0.81
63 0.81
64 0.78