Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V5N6S0

Protein Details
Accession A0A4V5N6S0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
62-83ADDGTKRRKKRNRWGDAQENKABasic
NLS Segment(s)
PositionSequence
66-74TKRRKKRNR
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR032570  SF1-HH  
IPR047086  SF1-HH_sf  
Pfam View protein in Pfam  
PF16275  SF1-HH  
Amino Acid Sequences MAWRSQGITGSNNIPLGNRRRFGGDSASPAAEDGGYNPSQPLTAIAENGGKRGRSPVRVELADDGTKRRKKRNRWGDAQENKAAGLMGLPTAIMANMTSEQLEAYTLHLRIEEISQKLRINDVVPADGDRSPSPPPQYDNFGRRVNTREYRYRKRLEEERHKLIEKAMKVIPNYHPPQRLPGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.32
4 0.36
5 0.35
6 0.34
7 0.38
8 0.39
9 0.4
10 0.41
11 0.36
12 0.34
13 0.36
14 0.35
15 0.3
16 0.28
17 0.26
18 0.18
19 0.14
20 0.09
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.11
30 0.12
31 0.12
32 0.13
33 0.18
34 0.18
35 0.2
36 0.2
37 0.16
38 0.16
39 0.23
40 0.26
41 0.27
42 0.32
43 0.36
44 0.4
45 0.4
46 0.41
47 0.36
48 0.35
49 0.33
50 0.29
51 0.26
52 0.29
53 0.34
54 0.37
55 0.44
56 0.49
57 0.57
58 0.67
59 0.74
60 0.75
61 0.79
62 0.84
63 0.84
64 0.83
65 0.77
66 0.69
67 0.57
68 0.48
69 0.38
70 0.3
71 0.18
72 0.11
73 0.06
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.02
81 0.02
82 0.03
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.04
91 0.06
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.09
98 0.11
99 0.13
100 0.13
101 0.15
102 0.17
103 0.19
104 0.19
105 0.19
106 0.18
107 0.15
108 0.16
109 0.15
110 0.14
111 0.13
112 0.13
113 0.14
114 0.14
115 0.15
116 0.13
117 0.14
118 0.15
119 0.19
120 0.22
121 0.23
122 0.26
123 0.27
124 0.34
125 0.39
126 0.41
127 0.43
128 0.44
129 0.43
130 0.43
131 0.44
132 0.46
133 0.47
134 0.49
135 0.53
136 0.58
137 0.67
138 0.73
139 0.76
140 0.73
141 0.73
142 0.76
143 0.77
144 0.79
145 0.77
146 0.77
147 0.76
148 0.72
149 0.64
150 0.61
151 0.57
152 0.47
153 0.43
154 0.39
155 0.37
156 0.36
157 0.41
158 0.42
159 0.44
160 0.48
161 0.51
162 0.52
163 0.5