Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V3W1

Protein Details
Accession A0A4U0V3W1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
106-125DEPKRDPSKRVPKQTARAKEBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 2
Family & Domain DBs
Pfam View protein in Pfam  
PF03232  COQ7  
Amino Acid Sequences MKHMYDQEAGHFKTFNELLAKHRIRPTVMYPRARQPATVDPVSEDDLGQPLTKKARHTLMNTPNVEIAAKYMYRKTVNDISWLEANPITTEQYRADLKAMGIPVADEPKRDPSKRVPKQTARAKEAERDSLVKTMDKVIQSLPTINQSLPTNTQSLPTKVQSQDTKTETTAPVAPRKIVTLKISGRVPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.23
4 0.23
5 0.26
6 0.36
7 0.38
8 0.38
9 0.43
10 0.43
11 0.4
12 0.43
13 0.48
14 0.48
15 0.54
16 0.56
17 0.54
18 0.6
19 0.66
20 0.62
21 0.54
22 0.48
23 0.49
24 0.47
25 0.45
26 0.36
27 0.3
28 0.32
29 0.33
30 0.28
31 0.19
32 0.13
33 0.13
34 0.14
35 0.12
36 0.11
37 0.11
38 0.16
39 0.18
40 0.2
41 0.23
42 0.29
43 0.34
44 0.38
45 0.46
46 0.5
47 0.56
48 0.54
49 0.51
50 0.45
51 0.39
52 0.35
53 0.24
54 0.16
55 0.1
56 0.1
57 0.1
58 0.11
59 0.14
60 0.16
61 0.17
62 0.21
63 0.26
64 0.26
65 0.3
66 0.29
67 0.28
68 0.28
69 0.27
70 0.23
71 0.16
72 0.16
73 0.11
74 0.1
75 0.1
76 0.08
77 0.1
78 0.09
79 0.11
80 0.12
81 0.11
82 0.12
83 0.11
84 0.11
85 0.11
86 0.11
87 0.08
88 0.08
89 0.07
90 0.07
91 0.11
92 0.11
93 0.09
94 0.11
95 0.19
96 0.25
97 0.26
98 0.29
99 0.35
100 0.46
101 0.54
102 0.63
103 0.64
104 0.66
105 0.75
106 0.81
107 0.8
108 0.73
109 0.7
110 0.62
111 0.6
112 0.55
113 0.49
114 0.41
115 0.35
116 0.31
117 0.29
118 0.28
119 0.22
120 0.2
121 0.19
122 0.21
123 0.19
124 0.19
125 0.17
126 0.19
127 0.19
128 0.2
129 0.18
130 0.18
131 0.19
132 0.18
133 0.2
134 0.18
135 0.21
136 0.22
137 0.23
138 0.22
139 0.2
140 0.26
141 0.26
142 0.28
143 0.3
144 0.29
145 0.34
146 0.34
147 0.41
148 0.42
149 0.43
150 0.47
151 0.46
152 0.46
153 0.41
154 0.43
155 0.37
156 0.34
157 0.35
158 0.31
159 0.36
160 0.35
161 0.36
162 0.32
163 0.35
164 0.36
165 0.36
166 0.34
167 0.36
168 0.37
169 0.42
170 0.43