Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XF48

Protein Details
Accession A0A4U0XF48    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-107PLAPAPRPRPRQPPQWRRRRRDDCYQVVHydrophilic
NLS Segment(s)
PositionSequence
81-100LAPAPRPRPRQPPQWRRRRR
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MSTAPASPSASRPAAPSLRAADCVVPPTTATTRTEDEDDEDGDEDDEDDYDGYGSDESNAGGQLARYRAPSAPTPRASAPLAPAPRPRPRQPPQWRRRRRDDCYQVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.3
4 0.29
5 0.29
6 0.3
7 0.29
8 0.24
9 0.21
10 0.23
11 0.21
12 0.16
13 0.14
14 0.17
15 0.17
16 0.17
17 0.18
18 0.19
19 0.2
20 0.22
21 0.23
22 0.19
23 0.21
24 0.2
25 0.18
26 0.15
27 0.14
28 0.12
29 0.1
30 0.1
31 0.07
32 0.06
33 0.05
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.06
51 0.08
52 0.09
53 0.09
54 0.11
55 0.12
56 0.15
57 0.21
58 0.26
59 0.33
60 0.34
61 0.36
62 0.36
63 0.38
64 0.36
65 0.31
66 0.27
67 0.28
68 0.29
69 0.29
70 0.35
71 0.38
72 0.46
73 0.53
74 0.56
75 0.59
76 0.63
77 0.7
78 0.75
79 0.8
80 0.81
81 0.85
82 0.89
83 0.88
84 0.93
85 0.92
86 0.88
87 0.88