Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MYB0

Protein Details
Accession A0A4S4MYB0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-67QELQKCVKRLKNVREKEPPPHydrophilic
NLS Segment(s)
PositionSequence
312-322KNRRGQRARRA
Subcellular Location(s) nucl 24, cyto_nucl 13.833, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR037393  Bud22/SRFB1  
IPR015158  Bud22_dom  
Pfam View protein in Pfam  
PF09073  BUD22  
Amino Acid Sequences MSQEGQTTGNKRKRTALDTTQDVGVKLKSKLHHGVIEVRRAVKKVKGQELQKCVKRLKNVREKEPPPFDISQLDAELNYLKALDVELFGDTALYSKLKKDKVLSSNEHFIDVLASELSGSLVAPAKPGSPEAKVDARLLSSKALASEVSTVLTSLRSIINPPPRVQRPNEVEDPEQDGPAHPKKTAKVLTAFSTEDGIDEEEASGDVSDRLVPEEEDDEVDDGGWESGSVNSEDEGVSEDEDGVSRGNYDEERDDSDDEFPPPKKSKLAAAGSKVATRPIGGSTFLPSLSVGFTRGDSDSEPEDVDDDGCKKNRRGQRARRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.61
4 0.62
5 0.63
6 0.63
7 0.58
8 0.52
9 0.46
10 0.39
11 0.32
12 0.29
13 0.25
14 0.28
15 0.27
16 0.33
17 0.39
18 0.42
19 0.43
20 0.41
21 0.49
22 0.49
23 0.54
24 0.51
25 0.48
26 0.46
27 0.44
28 0.45
29 0.41
30 0.43
31 0.45
32 0.51
33 0.54
34 0.6
35 0.67
36 0.72
37 0.75
38 0.74
39 0.72
40 0.68
41 0.66
42 0.68
43 0.69
44 0.71
45 0.72
46 0.73
47 0.76
48 0.8
49 0.79
50 0.79
51 0.76
52 0.68
53 0.63
54 0.56
55 0.49
56 0.4
57 0.38
58 0.3
59 0.24
60 0.21
61 0.15
62 0.14
63 0.14
64 0.12
65 0.09
66 0.07
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.11
83 0.17
84 0.2
85 0.23
86 0.27
87 0.35
88 0.41
89 0.49
90 0.51
91 0.5
92 0.55
93 0.52
94 0.48
95 0.39
96 0.32
97 0.24
98 0.18
99 0.13
100 0.06
101 0.05
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.08
114 0.1
115 0.11
116 0.11
117 0.12
118 0.15
119 0.18
120 0.19
121 0.19
122 0.18
123 0.17
124 0.17
125 0.16
126 0.14
127 0.11
128 0.1
129 0.09
130 0.09
131 0.08
132 0.07
133 0.08
134 0.07
135 0.07
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.06
143 0.05
144 0.07
145 0.13
146 0.2
147 0.22
148 0.24
149 0.3
150 0.34
151 0.37
152 0.38
153 0.41
154 0.39
155 0.42
156 0.44
157 0.4
158 0.37
159 0.34
160 0.38
161 0.3
162 0.25
163 0.2
164 0.16
165 0.19
166 0.23
167 0.23
168 0.18
169 0.2
170 0.21
171 0.29
172 0.32
173 0.29
174 0.29
175 0.3
176 0.32
177 0.32
178 0.31
179 0.24
180 0.21
181 0.18
182 0.13
183 0.12
184 0.1
185 0.07
186 0.06
187 0.06
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.05
197 0.06
198 0.07
199 0.07
200 0.07
201 0.09
202 0.09
203 0.09
204 0.09
205 0.08
206 0.08
207 0.08
208 0.06
209 0.06
210 0.05
211 0.05
212 0.04
213 0.04
214 0.05
215 0.06
216 0.07
217 0.07
218 0.07
219 0.08
220 0.07
221 0.07
222 0.09
223 0.08
224 0.08
225 0.08
226 0.08
227 0.07
228 0.07
229 0.08
230 0.06
231 0.05
232 0.05
233 0.06
234 0.07
235 0.08
236 0.1
237 0.12
238 0.14
239 0.18
240 0.2
241 0.21
242 0.21
243 0.23
244 0.23
245 0.22
246 0.25
247 0.23
248 0.28
249 0.3
250 0.32
251 0.33
252 0.33
253 0.38
254 0.43
255 0.5
256 0.5
257 0.5
258 0.54
259 0.52
260 0.53
261 0.46
262 0.38
263 0.3
264 0.24
265 0.2
266 0.17
267 0.17
268 0.15
269 0.16
270 0.18
271 0.19
272 0.18
273 0.17
274 0.14
275 0.13
276 0.14
277 0.13
278 0.11
279 0.1
280 0.11
281 0.13
282 0.14
283 0.15
284 0.14
285 0.17
286 0.18
287 0.19
288 0.19
289 0.16
290 0.16
291 0.15
292 0.15
293 0.14
294 0.15
295 0.2
296 0.26
297 0.32
298 0.36
299 0.44
300 0.52
301 0.6
302 0.68