Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q757N6

Protein Details
Accession Q757N6    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAGVKKNRSPRKPTKLLQSRLKFAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
IPR016181  Acyl_CoA_acyltransferase  
IPR028009  ESCO_Acetyltransf_dom  
IPR000182  GNAT_dom  
Gene Ontology GO:0000785  C:chromatin  
GO:0043596  C:nuclear replication fork  
GO:0005634  C:nucleus  
GO:0003682  F:chromatin binding  
GO:0046872  F:metal ion binding  
GO:0061733  F:peptide-lysine-N-acetyltransferase activity  
GO:0140588  P:chromatin looping  
GO:0006260  P:DNA replication  
GO:0006302  P:double-strand break repair  
GO:0034087  P:establishment of mitotic sister chromatid cohesion  
GO:0018393  P:internal peptidyl-lysine acetylation  
GO:0007076  P:mitotic chromosome condensation  
GO:0007064  P:mitotic sister chromatid cohesion  
GO:0007088  P:regulation of mitotic nuclear division  
GO:0032200  P:telomere organization  
GO:0070058  P:tRNA gene clustering  
KEGG ago:AGOS_AEL024C  -  
Pfam View protein in Pfam  
PF13880  Acetyltransf_13  
PF13878  zf-C2H2_3  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MAGVKKNRSPRKPTKLLQSRLKFAHSSATLKKCTECQMSYIIDSPADCAEHKKYHDLHLYGKKWLASWGTAIQDTCSSQYITPPSTSGGNASGNGAKADREDYIVYITPGKTAEVKAMMEIMYIVNNELTAPHDENDFWSEEGTSSMGRAFVYIKDGRAVGAITVEYLKEDDSRGRWMRVSTRELVPEVVPRVRLGISRIWVCRKQRGQGIATRLLECVRKYAILGNEVARWEMAWSQPSESGGKLATRYNSVRHKSGELLIPCYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.86
5 0.83
6 0.79
7 0.73
8 0.71
9 0.6
10 0.5
11 0.5
12 0.43
13 0.42
14 0.43
15 0.46
16 0.46
17 0.46
18 0.47
19 0.42
20 0.45
21 0.46
22 0.38
23 0.34
24 0.35
25 0.36
26 0.36
27 0.34
28 0.28
29 0.22
30 0.2
31 0.19
32 0.15
33 0.14
34 0.13
35 0.14
36 0.19
37 0.24
38 0.26
39 0.31
40 0.32
41 0.38
42 0.46
43 0.44
44 0.47
45 0.52
46 0.52
47 0.48
48 0.48
49 0.42
50 0.34
51 0.35
52 0.28
53 0.19
54 0.2
55 0.2
56 0.2
57 0.2
58 0.2
59 0.17
60 0.17
61 0.17
62 0.15
63 0.13
64 0.12
65 0.11
66 0.15
67 0.17
68 0.18
69 0.17
70 0.17
71 0.17
72 0.17
73 0.17
74 0.14
75 0.13
76 0.12
77 0.12
78 0.13
79 0.13
80 0.12
81 0.12
82 0.11
83 0.09
84 0.09
85 0.1
86 0.09
87 0.09
88 0.09
89 0.09
90 0.11
91 0.11
92 0.11
93 0.12
94 0.11
95 0.1
96 0.1
97 0.11
98 0.1
99 0.1
100 0.11
101 0.1
102 0.1
103 0.09
104 0.1
105 0.09
106 0.08
107 0.08
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.05
117 0.07
118 0.08
119 0.08
120 0.09
121 0.09
122 0.1
123 0.11
124 0.11
125 0.08
126 0.08
127 0.08
128 0.07
129 0.08
130 0.08
131 0.06
132 0.05
133 0.05
134 0.06
135 0.05
136 0.06
137 0.06
138 0.06
139 0.11
140 0.12
141 0.12
142 0.12
143 0.12
144 0.12
145 0.12
146 0.11
147 0.06
148 0.06
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.07
158 0.09
159 0.1
160 0.18
161 0.2
162 0.21
163 0.23
164 0.25
165 0.31
166 0.34
167 0.37
168 0.34
169 0.34
170 0.35
171 0.34
172 0.33
173 0.27
174 0.25
175 0.23
176 0.21
177 0.19
178 0.17
179 0.17
180 0.17
181 0.17
182 0.16
183 0.17
184 0.2
185 0.24
186 0.28
187 0.33
188 0.39
189 0.42
190 0.49
191 0.5
192 0.51
193 0.53
194 0.55
195 0.53
196 0.53
197 0.55
198 0.53
199 0.5
200 0.45
201 0.39
202 0.35
203 0.34
204 0.29
205 0.25
206 0.19
207 0.17
208 0.17
209 0.22
210 0.23
211 0.22
212 0.24
213 0.23
214 0.24
215 0.24
216 0.24
217 0.18
218 0.14
219 0.13
220 0.13
221 0.14
222 0.15
223 0.16
224 0.18
225 0.2
226 0.22
227 0.22
228 0.21
229 0.2
230 0.17
231 0.18
232 0.18
233 0.21
234 0.21
235 0.26
236 0.28
237 0.35
238 0.43
239 0.47
240 0.5
241 0.49
242 0.5
243 0.48
244 0.5
245 0.5
246 0.43