Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MS48

Protein Details
Accession A0A4S4MS48   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-46QTPKVEKQEKKKVPKGRAKKRILYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVEKQEKKKVPKGRAKKRI
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKVPKGRAKKRILYNRRFVNVTLLPNGKRKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.49
5 0.52
6 0.61
7 0.64
8 0.7
9 0.7
10 0.73
11 0.76
12 0.76
13 0.79
14 0.78
15 0.78
16 0.77
17 0.8
18 0.81
19 0.82
20 0.83
21 0.81
22 0.81
23 0.83
24 0.84
25 0.85
26 0.82
27 0.8
28 0.78
29 0.75
30 0.68
31 0.59
32 0.56
33 0.5
34 0.45
35 0.42
36 0.39
37 0.38