Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V6S1T6

Protein Details
Accession A0A4V6S1T6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-65IDSSQKEKKRRIQHAEDDARCVKRKRDKDVVKRDKADBasic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MYKTNNTAAYIDDMLPVDLQYIRQVAREIDSSQKEKKRRIQHAEDDARCVKRKRDKDVVKRDKADQKETMLNGLQPRLEVGEIEAKPGTVAEIDMELDWHRRSDSLVPLKSRMKNKVEKLTQLLAAVKRYHERVSEPRMDVGDKSNIKRDIEMERGDENEEAGEVVVLTGSGNVSDCDSDAEFDWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.11
5 0.1
6 0.1
7 0.1
8 0.12
9 0.12
10 0.13
11 0.15
12 0.15
13 0.17
14 0.19
15 0.19
16 0.25
17 0.3
18 0.33
19 0.4
20 0.47
21 0.51
22 0.57
23 0.64
24 0.66
25 0.71
26 0.76
27 0.77
28 0.79
29 0.83
30 0.85
31 0.77
32 0.72
33 0.67
34 0.61
35 0.57
36 0.5
37 0.47
38 0.47
39 0.53
40 0.56
41 0.62
42 0.68
43 0.74
44 0.83
45 0.85
46 0.84
47 0.79
48 0.78
49 0.75
50 0.69
51 0.64
52 0.55
53 0.48
54 0.45
55 0.42
56 0.37
57 0.3
58 0.27
59 0.23
60 0.21
61 0.17
62 0.12
63 0.12
64 0.1
65 0.09
66 0.07
67 0.07
68 0.13
69 0.13
70 0.15
71 0.14
72 0.13
73 0.13
74 0.13
75 0.12
76 0.04
77 0.04
78 0.03
79 0.03
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.11
91 0.19
92 0.25
93 0.29
94 0.3
95 0.34
96 0.4
97 0.44
98 0.46
99 0.46
100 0.45
101 0.49
102 0.55
103 0.6
104 0.58
105 0.56
106 0.55
107 0.51
108 0.45
109 0.38
110 0.35
111 0.27
112 0.27
113 0.24
114 0.21
115 0.21
116 0.22
117 0.23
118 0.21
119 0.25
120 0.29
121 0.36
122 0.41
123 0.4
124 0.4
125 0.39
126 0.38
127 0.34
128 0.3
129 0.31
130 0.29
131 0.3
132 0.35
133 0.37
134 0.37
135 0.37
136 0.36
137 0.34
138 0.35
139 0.35
140 0.31
141 0.29
142 0.29
143 0.29
144 0.26
145 0.2
146 0.15
147 0.12
148 0.09
149 0.07
150 0.06
151 0.04
152 0.04
153 0.04
154 0.04
155 0.03
156 0.04
157 0.04
158 0.04
159 0.05
160 0.05
161 0.07
162 0.07
163 0.08
164 0.11
165 0.11
166 0.12