Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4N1A8

Protein Details
Accession A0A4S4N1A8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
114-140GPGPVRTKARPVKEKKKPKTMEQLDSEHydrophilic
NLS Segment(s)
PositionSequence
96-132KSKAKPTARPAKAAAASNGPGPVRTKARPVKEKKKPK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MNLNNPYPSPYVKYDRSGRSSGVAIIFYETAQEAAQAKQEFNGKFAKGQPMEIEFDAGPTPRPNLNTRHAASAPSLINRIQKPPLLERLGDVTTSKSKAKPTARPAKAAAASNGPGPVRTKARPVKEKKKPKTMEQLDSELDAFMHDDDAAPSTGDVAMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.57
4 0.55
5 0.5
6 0.45
7 0.42
8 0.38
9 0.31
10 0.24
11 0.18
12 0.17
13 0.16
14 0.13
15 0.12
16 0.1
17 0.08
18 0.07
19 0.09
20 0.08
21 0.09
22 0.14
23 0.15
24 0.15
25 0.17
26 0.23
27 0.22
28 0.23
29 0.27
30 0.22
31 0.24
32 0.27
33 0.33
34 0.27
35 0.28
36 0.28
37 0.26
38 0.28
39 0.25
40 0.24
41 0.15
42 0.15
43 0.14
44 0.13
45 0.11
46 0.09
47 0.11
48 0.11
49 0.14
50 0.16
51 0.21
52 0.26
53 0.32
54 0.32
55 0.35
56 0.33
57 0.32
58 0.29
59 0.28
60 0.24
61 0.17
62 0.17
63 0.14
64 0.18
65 0.18
66 0.2
67 0.18
68 0.18
69 0.2
70 0.22
71 0.27
72 0.24
73 0.23
74 0.22
75 0.23
76 0.22
77 0.2
78 0.17
79 0.13
80 0.14
81 0.17
82 0.18
83 0.16
84 0.18
85 0.26
86 0.33
87 0.38
88 0.46
89 0.55
90 0.55
91 0.57
92 0.57
93 0.55
94 0.52
95 0.45
96 0.37
97 0.29
98 0.27
99 0.24
100 0.25
101 0.18
102 0.16
103 0.16
104 0.19
105 0.21
106 0.22
107 0.3
108 0.36
109 0.46
110 0.55
111 0.63
112 0.69
113 0.75
114 0.85
115 0.85
116 0.88
117 0.85
118 0.83
119 0.85
120 0.82
121 0.8
122 0.74
123 0.7
124 0.6
125 0.56
126 0.47
127 0.36
128 0.27
129 0.18
130 0.14
131 0.09
132 0.08
133 0.06
134 0.07
135 0.07
136 0.09
137 0.1
138 0.09
139 0.09
140 0.09