Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4N2E1

Protein Details
Accession A0A4S4N2E1    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAPEAVKKPKGQKKEKIFHPLSRKADHydrophilic
NLS Segment(s)
PositionSequence
7-25KKPKGQKKEKIFHPLSRKA
32-47QVRKGKLAGLTKARWR
96-103ARRKGRPK
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MAPEAVKKPKGQKKEKIFHPLSRKADQLVRTQVRKGKLAGLTKARWRKHGEQVNLFGFFFHAIPPQGELTLEEMHAVVRDVWATRFDSELEAERAARRKGRPKSTKEHNIESLQEREAEQYRTGLEVIDLTHPTNVELFRQWDQKELAYIQELRFIRISSDTPDSFVISRPGKHPFLITEAAEKREQEAETMDLDDVPLLVEAPSRFASTMMTMDGPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.86
4 0.84
5 0.82
6 0.82
7 0.81
8 0.77
9 0.71
10 0.64
11 0.57
12 0.57
13 0.52
14 0.5
15 0.5
16 0.52
17 0.5
18 0.54
19 0.55
20 0.53
21 0.53
22 0.47
23 0.43
24 0.42
25 0.45
26 0.46
27 0.48
28 0.49
29 0.54
30 0.62
31 0.57
32 0.57
33 0.59
34 0.59
35 0.62
36 0.66
37 0.65
38 0.63
39 0.67
40 0.64
41 0.57
42 0.5
43 0.4
44 0.31
45 0.24
46 0.17
47 0.11
48 0.1
49 0.09
50 0.09
51 0.11
52 0.11
53 0.1
54 0.1
55 0.1
56 0.11
57 0.11
58 0.1
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.08
70 0.09
71 0.09
72 0.1
73 0.1
74 0.11
75 0.11
76 0.13
77 0.13
78 0.12
79 0.12
80 0.14
81 0.17
82 0.18
83 0.21
84 0.23
85 0.31
86 0.39
87 0.5
88 0.56
89 0.59
90 0.66
91 0.71
92 0.77
93 0.72
94 0.69
95 0.62
96 0.55
97 0.51
98 0.46
99 0.37
100 0.28
101 0.23
102 0.19
103 0.17
104 0.17
105 0.16
106 0.13
107 0.12
108 0.12
109 0.12
110 0.12
111 0.09
112 0.07
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.09
119 0.09
120 0.09
121 0.1
122 0.09
123 0.09
124 0.1
125 0.13
126 0.15
127 0.21
128 0.21
129 0.23
130 0.24
131 0.23
132 0.24
133 0.21
134 0.2
135 0.17
136 0.19
137 0.16
138 0.22
139 0.21
140 0.21
141 0.21
142 0.2
143 0.18
144 0.18
145 0.19
146 0.16
147 0.21
148 0.2
149 0.2
150 0.21
151 0.21
152 0.2
153 0.2
154 0.23
155 0.2
156 0.22
157 0.23
158 0.28
159 0.29
160 0.29
161 0.29
162 0.24
163 0.27
164 0.28
165 0.26
166 0.28
167 0.29
168 0.32
169 0.32
170 0.3
171 0.28
172 0.28
173 0.27
174 0.2
175 0.2
176 0.18
177 0.18
178 0.19
179 0.17
180 0.12
181 0.12
182 0.11
183 0.08
184 0.07
185 0.06
186 0.05
187 0.05
188 0.08
189 0.08
190 0.12
191 0.13
192 0.14
193 0.14
194 0.14
195 0.16
196 0.15
197 0.16
198 0.15
199 0.15