Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MVF7

Protein Details
Accession A0A4S4MVF7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
161-180MSAVRKGKRKARSDSPPLDDHydrophilic
NLS Segment(s)
PositionSequence
166-171KGKRKA
Subcellular Location(s) mito 19.5, cyto_mito 13.833, mito_nucl 11.166, cyto 6
Family & Domain DBs
Amino Acid Sequences MPPKVQPKTYILSVKTHKVTFFITASQTSTIASLKAEVLSALQAPVLTSPTPAPFSGTAAMDVDDAEEWKVPTVSSEDEFELCRAIKDKGKPSGRYERMEGRTTIKASFVNWDMVFVQFKDTEKGIFHPVKVSLPSMLEDDEDEQPEAPPPPPPPQDEAEMSAVRKGKRKARSDSPPLDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.51
4 0.44
5 0.39
6 0.39
7 0.35
8 0.31
9 0.26
10 0.24
11 0.23
12 0.24
13 0.23
14 0.21
15 0.16
16 0.16
17 0.14
18 0.11
19 0.1
20 0.09
21 0.09
22 0.09
23 0.09
24 0.07
25 0.07
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.08
34 0.07
35 0.07
36 0.09
37 0.11
38 0.13
39 0.12
40 0.15
41 0.13
42 0.15
43 0.16
44 0.15
45 0.14
46 0.12
47 0.13
48 0.1
49 0.09
50 0.08
51 0.06
52 0.06
53 0.05
54 0.06
55 0.05
56 0.06
57 0.06
58 0.05
59 0.06
60 0.08
61 0.09
62 0.09
63 0.11
64 0.11
65 0.11
66 0.12
67 0.11
68 0.11
69 0.09
70 0.08
71 0.09
72 0.1
73 0.14
74 0.18
75 0.24
76 0.32
77 0.38
78 0.41
79 0.45
80 0.54
81 0.55
82 0.52
83 0.5
84 0.49
85 0.48
86 0.47
87 0.42
88 0.35
89 0.33
90 0.32
91 0.29
92 0.22
93 0.18
94 0.17
95 0.19
96 0.16
97 0.17
98 0.15
99 0.16
100 0.15
101 0.16
102 0.16
103 0.13
104 0.14
105 0.11
106 0.12
107 0.13
108 0.13
109 0.13
110 0.13
111 0.16
112 0.21
113 0.21
114 0.21
115 0.21
116 0.22
117 0.23
118 0.24
119 0.23
120 0.16
121 0.16
122 0.16
123 0.15
124 0.14
125 0.12
126 0.12
127 0.13
128 0.14
129 0.14
130 0.14
131 0.13
132 0.13
133 0.15
134 0.15
135 0.13
136 0.15
137 0.17
138 0.25
139 0.29
140 0.32
141 0.34
142 0.35
143 0.4
144 0.38
145 0.39
146 0.36
147 0.34
148 0.31
149 0.31
150 0.33
151 0.31
152 0.36
153 0.4
154 0.43
155 0.5
156 0.59
157 0.63
158 0.69
159 0.77
160 0.8