Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3XIV8

Protein Details
Accession A0A4V3XIV8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPAQPFPTPRTPKKYKHIPQPASPLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MPAQPFPTPRTPKKYKHIPQPASPLDKYSRPLPPRLPSLRPWKETCRNYSKATSSRTSICNGPSRTNAYDQRDTRVQVRFVNYPPELYEFYYMTDSEDDGSSSEPNAPPSVKRAGGKVEEESSGRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.82
4 0.85
5 0.82
6 0.81
7 0.82
8 0.79
9 0.75
10 0.66
11 0.59
12 0.52
13 0.49
14 0.44
15 0.4
16 0.42
17 0.38
18 0.43
19 0.45
20 0.47
21 0.52
22 0.55
23 0.54
24 0.52
25 0.6
26 0.62
27 0.6
28 0.59
29 0.59
30 0.63
31 0.64
32 0.65
33 0.63
34 0.59
35 0.58
36 0.58
37 0.55
38 0.51
39 0.5
40 0.45
41 0.39
42 0.38
43 0.35
44 0.33
45 0.28
46 0.26
47 0.29
48 0.28
49 0.28
50 0.27
51 0.3
52 0.29
53 0.32
54 0.35
55 0.34
56 0.39
57 0.38
58 0.4
59 0.38
60 0.38
61 0.37
62 0.36
63 0.32
64 0.27
65 0.3
66 0.29
67 0.28
68 0.33
69 0.29
70 0.26
71 0.25
72 0.25
73 0.23
74 0.2
75 0.21
76 0.15
77 0.16
78 0.17
79 0.16
80 0.14
81 0.13
82 0.12
83 0.1
84 0.1
85 0.09
86 0.08
87 0.1
88 0.09
89 0.09
90 0.12
91 0.12
92 0.14
93 0.16
94 0.17
95 0.17
96 0.21
97 0.27
98 0.28
99 0.28
100 0.3
101 0.34
102 0.38
103 0.4
104 0.4
105 0.37
106 0.34