Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FM93

Protein Details
Accession C5FM93    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
130-152VALKKQKAKEVKKSKKKAGSEKTBasic
NLS Segment(s)
PositionSequence
123-148KKAERREVALKKQKAKEVKKSKKKAG
Subcellular Location(s) cysk 13, cyto 9, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011856  tRNA_endonuc-like_dom_sf  
IPR036167  tRNA_intron_Endo_cat-like_sf  
IPR006677  tRNA_intron_Endonuc_cat-like  
IPR006676  tRNA_splic  
IPR016690  tRNA_splic_SEN34  
Gene Ontology GO:0000214  C:tRNA-intron endonuclease complex  
GO:0016829  F:lyase activity  
GO:0003676  F:nucleic acid binding  
GO:0000213  F:tRNA-intron endonuclease activity  
GO:0000379  P:tRNA-type intron splice site recognition and cleavage  
Pfam View protein in Pfam  
PF01974  tRNA_int_endo  
CDD cd22363  tRNA-intron_lyase_C  
Amino Acid Sequences MDNKSCLATGEEPELPIPISLISGRYFLFSIDAVTYLRREHHICGVLVGTLPQVPQQNVFLGLPLELMPEEARLLVEKEVAYVIDDTQAHAQGVRNLSEENKRQYLNELNQNGRQVSLFLAGKKAERREVALKKQKAKEVKKSKKKAGSEKTEIEEETPSHAEPEVESYDELLFAPPKKPAVEEVAAASRVSLDVGEHILEVTPATSHGLLPRTAPTVPAFLPEAPPSYPLFAHLHSQGYFLSPGLRFGCQYMAYPGDPLRFHSHFLVSSIEWDEEFDLMDLVAGGRLGTGVKKGYLVGGSEESDVDGRPKRTVRTFSLEWAGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.16
4 0.14
5 0.09
6 0.09
7 0.09
8 0.11
9 0.11
10 0.12
11 0.12
12 0.13
13 0.13
14 0.12
15 0.13
16 0.11
17 0.12
18 0.11
19 0.12
20 0.11
21 0.12
22 0.13
23 0.13
24 0.15
25 0.18
26 0.2
27 0.22
28 0.29
29 0.32
30 0.31
31 0.3
32 0.29
33 0.25
34 0.23
35 0.2
36 0.13
37 0.09
38 0.09
39 0.11
40 0.14
41 0.14
42 0.16
43 0.17
44 0.17
45 0.19
46 0.19
47 0.16
48 0.13
49 0.12
50 0.11
51 0.09
52 0.09
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.07
60 0.07
61 0.09
62 0.08
63 0.1
64 0.09
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.1
72 0.1
73 0.11
74 0.12
75 0.13
76 0.12
77 0.13
78 0.14
79 0.14
80 0.17
81 0.16
82 0.16
83 0.15
84 0.19
85 0.25
86 0.29
87 0.3
88 0.32
89 0.31
90 0.31
91 0.34
92 0.39
93 0.38
94 0.42
95 0.41
96 0.4
97 0.42
98 0.44
99 0.4
100 0.32
101 0.26
102 0.18
103 0.14
104 0.15
105 0.14
106 0.12
107 0.14
108 0.15
109 0.18
110 0.21
111 0.23
112 0.22
113 0.22
114 0.26
115 0.33
116 0.39
117 0.47
118 0.53
119 0.56
120 0.61
121 0.64
122 0.65
123 0.66
124 0.66
125 0.66
126 0.68
127 0.73
128 0.76
129 0.8
130 0.83
131 0.81
132 0.81
133 0.81
134 0.79
135 0.77
136 0.72
137 0.68
138 0.61
139 0.54
140 0.47
141 0.37
142 0.28
143 0.2
144 0.16
145 0.13
146 0.11
147 0.1
148 0.1
149 0.09
150 0.08
151 0.11
152 0.09
153 0.08
154 0.08
155 0.09
156 0.08
157 0.09
158 0.09
159 0.06
160 0.07
161 0.07
162 0.09
163 0.09
164 0.1
165 0.11
166 0.11
167 0.12
168 0.16
169 0.16
170 0.16
171 0.16
172 0.17
173 0.17
174 0.16
175 0.14
176 0.09
177 0.08
178 0.07
179 0.05
180 0.03
181 0.04
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.03
191 0.04
192 0.05
193 0.05
194 0.05
195 0.08
196 0.1
197 0.11
198 0.12
199 0.13
200 0.14
201 0.14
202 0.15
203 0.14
204 0.14
205 0.14
206 0.15
207 0.15
208 0.13
209 0.16
210 0.15
211 0.16
212 0.14
213 0.16
214 0.15
215 0.15
216 0.14
217 0.15
218 0.17
219 0.16
220 0.18
221 0.19
222 0.21
223 0.19
224 0.21
225 0.17
226 0.16
227 0.16
228 0.13
229 0.15
230 0.12
231 0.15
232 0.16
233 0.16
234 0.15
235 0.15
236 0.18
237 0.15
238 0.16
239 0.16
240 0.17
241 0.17
242 0.18
243 0.19
244 0.2
245 0.2
246 0.23
247 0.27
248 0.26
249 0.28
250 0.29
251 0.29
252 0.26
253 0.27
254 0.26
255 0.18
256 0.2
257 0.2
258 0.18
259 0.15
260 0.15
261 0.14
262 0.11
263 0.11
264 0.09
265 0.07
266 0.06
267 0.06
268 0.05
269 0.05
270 0.05
271 0.04
272 0.04
273 0.03
274 0.04
275 0.05
276 0.06
277 0.08
278 0.1
279 0.1
280 0.11
281 0.12
282 0.14
283 0.15
284 0.15
285 0.16
286 0.17
287 0.18
288 0.18
289 0.17
290 0.16
291 0.15
292 0.15
293 0.16
294 0.2
295 0.21
296 0.26
297 0.3
298 0.37
299 0.44
300 0.51
301 0.53
302 0.55
303 0.56
304 0.56