Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3XJI4

Protein Details
Accession A0A4V3XJI4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
249-273AGSENKNQKKAAKKARKKAKKSSPTHydrophilic
NLS Segment(s)
PositionSequence
254-272KNQKKAAKKARKKAKKSSP
Subcellular Location(s) nucl 16, cyto_nucl 13.333, cyto 9.5, mito_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Amino Acid Sequences MSDAKIRAKLKILNESLDELDETLEPLFAQTLPEVLAGLETLQQAKLQVDIPYVVYDLVFSVCSLGSLPAFSRADSYCKKLDGVRQYFDKIKKAEEGPEKRKNVLDQGVANRFIKHAIAQVNLQRPPADNHAGPSDVRVPVKVTSKMAARAQYEKELEELGDEEASDLEVFEDEPAAPDADEPVTLSGKSKEKGNATESVESEPLATPPTSGVGKKRRRAAIDPFAGYGDSPAGSGTEGPGSGQSTPMAGSENKNQKKAAKKARKKAKKSSPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.4
4 0.35
5 0.29
6 0.19
7 0.17
8 0.14
9 0.12
10 0.09
11 0.08
12 0.07
13 0.07
14 0.08
15 0.07
16 0.08
17 0.07
18 0.07
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.06
25 0.06
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.1
33 0.12
34 0.12
35 0.12
36 0.13
37 0.13
38 0.14
39 0.13
40 0.13
41 0.12
42 0.09
43 0.08
44 0.07
45 0.07
46 0.06
47 0.05
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.06
54 0.07
55 0.07
56 0.13
57 0.14
58 0.13
59 0.16
60 0.16
61 0.23
62 0.24
63 0.29
64 0.25
65 0.25
66 0.27
67 0.27
68 0.33
69 0.37
70 0.39
71 0.39
72 0.39
73 0.41
74 0.47
75 0.47
76 0.46
77 0.37
78 0.34
79 0.35
80 0.34
81 0.38
82 0.41
83 0.48
84 0.5
85 0.58
86 0.58
87 0.55
88 0.56
89 0.5
90 0.45
91 0.4
92 0.34
93 0.29
94 0.33
95 0.35
96 0.35
97 0.34
98 0.28
99 0.24
100 0.21
101 0.18
102 0.12
103 0.13
104 0.12
105 0.13
106 0.15
107 0.2
108 0.24
109 0.25
110 0.25
111 0.21
112 0.2
113 0.21
114 0.24
115 0.22
116 0.17
117 0.18
118 0.19
119 0.19
120 0.18
121 0.17
122 0.15
123 0.13
124 0.13
125 0.12
126 0.12
127 0.14
128 0.19
129 0.19
130 0.17
131 0.17
132 0.19
133 0.22
134 0.23
135 0.25
136 0.23
137 0.25
138 0.26
139 0.28
140 0.27
141 0.23
142 0.22
143 0.18
144 0.16
145 0.12
146 0.11
147 0.07
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.03
156 0.03
157 0.04
158 0.03
159 0.04
160 0.04
161 0.05
162 0.06
163 0.06
164 0.06
165 0.06
166 0.07
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.09
174 0.12
175 0.17
176 0.18
177 0.21
178 0.25
179 0.28
180 0.32
181 0.34
182 0.36
183 0.36
184 0.39
185 0.36
186 0.33
187 0.3
188 0.26
189 0.23
190 0.17
191 0.14
192 0.12
193 0.11
194 0.08
195 0.08
196 0.11
197 0.12
198 0.14
199 0.22
200 0.3
201 0.39
202 0.46
203 0.54
204 0.58
205 0.62
206 0.66
207 0.68
208 0.68
209 0.66
210 0.61
211 0.53
212 0.47
213 0.41
214 0.35
215 0.26
216 0.16
217 0.09
218 0.07
219 0.07
220 0.06
221 0.06
222 0.07
223 0.07
224 0.07
225 0.07
226 0.08
227 0.09
228 0.1
229 0.1
230 0.11
231 0.1
232 0.1
233 0.1
234 0.1
235 0.12
236 0.12
237 0.16
238 0.25
239 0.36
240 0.41
241 0.44
242 0.47
243 0.51
244 0.59
245 0.66
246 0.68
247 0.68
248 0.73
249 0.81
250 0.89
251 0.93
252 0.92
253 0.93