Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LVX2

Protein Details
Accession A0A4S4LVX2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25NPNVVRKRYSRDLRHRVIHQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF13384  HTH_23  
Amino Acid Sequences MVRLWNPNVVRKRYSRDLRHRVIHQHCVLGHTTTQVATHLDIPLRVVQRTLQHWREIGDVVKAPGVTGRKAILGDNEIEFLFALLERSPDLFLDEIAEELDAMHGVTKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.73
4 0.78
5 0.8
6 0.81
7 0.79
8 0.78
9 0.75
10 0.73
11 0.64
12 0.58
13 0.5
14 0.45
15 0.41
16 0.32
17 0.26
18 0.18
19 0.16
20 0.12
21 0.12
22 0.11
23 0.1
24 0.09
25 0.1
26 0.1
27 0.1
28 0.1
29 0.11
30 0.14
31 0.14
32 0.13
33 0.12
34 0.13
35 0.17
36 0.22
37 0.28
38 0.26
39 0.26
40 0.27
41 0.27
42 0.26
43 0.24
44 0.19
45 0.14
46 0.12
47 0.11
48 0.11
49 0.1
50 0.09
51 0.11
52 0.12
53 0.1
54 0.11
55 0.11
56 0.11
57 0.12
58 0.13
59 0.12
60 0.12
61 0.13
62 0.12
63 0.12
64 0.11
65 0.11
66 0.1
67 0.08
68 0.07
69 0.05
70 0.06
71 0.05
72 0.06
73 0.06
74 0.07
75 0.08
76 0.08
77 0.1
78 0.09
79 0.09
80 0.1
81 0.1
82 0.09
83 0.09
84 0.09
85 0.07
86 0.07
87 0.07
88 0.05
89 0.05