Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FFH1

Protein Details
Accession C5FFH1    Localization Confidence High Confidence Score 20.3
NoLS Segment(s)
PositionSequenceProtein Nature
221-248RFLPQLKKRTLSKRRKPFKVTDKSKKVYHydrophilic
302-349DYIPPKEDTGEKKKKKRKRHEDYDEDARNGDDVEKKVKHKKSSKKEKABasic
NLS Segment(s)
PositionSequence
227-243KKRTLSKRRKPFKVTDK
276-321KERARKEEIMEKQREKRAEKMKEQEKDYIPPKEDTGEKKKKKRKRH
336-349KKVKHKKSSKKEKA
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR041174  KH_8  
IPR004087  KH_dom  
IPR036612  KH_dom_type_1_sf  
IPR024166  rRNA_assembly_KRR1  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF17903  KH_8  
CDD cd22393  KH-I_KRR1_rpt1  
cd22394  KH-I_KRR1_rpt2  
Amino Acid Sequences MPSTYKRDKPWDTDDIDKWKIEEFKPSDNVGGTFTEESSFVSLFPKYREIYLREVWPLITKALEKNGIACTLDLVEGSMTVKTTRKTFDPAAILKARDLIKLLARSVPAPQALKILEDDVACDIIKIRNLVRNKERFVKRRQRILGPSGSTLKALELLTNTYLLVQGNTVAAMGPFKGLKEVRRVVEDCMNNIHPIYHIKELMIKRELAKDPQLAEESWDRFLPQLKKRTLSKRRKPFKVTDKSKKVYTPFPPAQEKSKVDLQIESGEYFLSKQAKERARKEEIMEKQREKRAEKMKEQEKDYIPPKEDTGEKKKKKRKRHEDYDEDARNGDDVEKKVKHKKSSKKEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.64
3 0.6
4 0.53
5 0.46
6 0.43
7 0.45
8 0.38
9 0.41
10 0.37
11 0.42
12 0.46
13 0.46
14 0.43
15 0.39
16 0.39
17 0.3
18 0.27
19 0.22
20 0.18
21 0.17
22 0.15
23 0.13
24 0.14
25 0.14
26 0.13
27 0.1
28 0.11
29 0.13
30 0.15
31 0.17
32 0.22
33 0.2
34 0.25
35 0.3
36 0.32
37 0.37
38 0.39
39 0.41
40 0.38
41 0.38
42 0.34
43 0.32
44 0.29
45 0.23
46 0.21
47 0.19
48 0.19
49 0.23
50 0.26
51 0.22
52 0.23
53 0.24
54 0.24
55 0.22
56 0.19
57 0.15
58 0.13
59 0.13
60 0.1
61 0.08
62 0.06
63 0.06
64 0.07
65 0.06
66 0.06
67 0.08
68 0.11
69 0.12
70 0.15
71 0.18
72 0.2
73 0.25
74 0.27
75 0.31
76 0.35
77 0.35
78 0.38
79 0.39
80 0.37
81 0.31
82 0.35
83 0.3
84 0.24
85 0.23
86 0.19
87 0.2
88 0.22
89 0.23
90 0.2
91 0.2
92 0.2
93 0.2
94 0.21
95 0.19
96 0.18
97 0.17
98 0.18
99 0.18
100 0.18
101 0.16
102 0.14
103 0.13
104 0.11
105 0.12
106 0.09
107 0.1
108 0.09
109 0.08
110 0.09
111 0.08
112 0.1
113 0.11
114 0.12
115 0.17
116 0.21
117 0.28
118 0.36
119 0.41
120 0.43
121 0.52
122 0.58
123 0.59
124 0.67
125 0.71
126 0.69
127 0.72
128 0.73
129 0.71
130 0.68
131 0.66
132 0.62
133 0.53
134 0.48
135 0.42
136 0.37
137 0.3
138 0.24
139 0.18
140 0.15
141 0.13
142 0.11
143 0.08
144 0.09
145 0.09
146 0.09
147 0.09
148 0.06
149 0.07
150 0.06
151 0.06
152 0.05
153 0.05
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.03
161 0.04
162 0.04
163 0.04
164 0.07
165 0.09
166 0.11
167 0.18
168 0.22
169 0.22
170 0.26
171 0.28
172 0.27
173 0.32
174 0.31
175 0.25
176 0.25
177 0.24
178 0.2
179 0.19
180 0.17
181 0.11
182 0.13
183 0.15
184 0.14
185 0.13
186 0.13
187 0.2
188 0.21
189 0.25
190 0.24
191 0.22
192 0.21
193 0.27
194 0.29
195 0.25
196 0.28
197 0.26
198 0.25
199 0.26
200 0.26
201 0.2
202 0.21
203 0.22
204 0.2
205 0.19
206 0.18
207 0.16
208 0.15
209 0.22
210 0.27
211 0.3
212 0.37
213 0.39
214 0.45
215 0.52
216 0.62
217 0.67
218 0.7
219 0.74
220 0.76
221 0.83
222 0.87
223 0.86
224 0.85
225 0.85
226 0.85
227 0.85
228 0.85
229 0.85
230 0.8
231 0.77
232 0.72
233 0.65
234 0.62
235 0.58
236 0.57
237 0.52
238 0.54
239 0.58
240 0.55
241 0.57
242 0.57
243 0.53
244 0.48
245 0.49
246 0.45
247 0.39
248 0.37
249 0.33
250 0.3
251 0.29
252 0.24
253 0.18
254 0.15
255 0.14
256 0.13
257 0.15
258 0.14
259 0.13
260 0.18
261 0.26
262 0.35
263 0.44
264 0.51
265 0.56
266 0.59
267 0.62
268 0.62
269 0.63
270 0.64
271 0.65
272 0.67
273 0.65
274 0.66
275 0.69
276 0.72
277 0.66
278 0.66
279 0.67
280 0.68
281 0.7
282 0.72
283 0.75
284 0.75
285 0.75
286 0.74
287 0.67
288 0.66
289 0.64
290 0.61
291 0.55
292 0.5
293 0.47
294 0.43
295 0.45
296 0.46
297 0.5
298 0.53
299 0.6
300 0.69
301 0.78
302 0.83
303 0.88
304 0.91
305 0.91
306 0.91
307 0.93
308 0.93
309 0.93
310 0.91
311 0.91
312 0.86
313 0.76
314 0.65
315 0.54
316 0.43
317 0.34
318 0.29
319 0.24
320 0.21
321 0.29
322 0.34
323 0.41
324 0.51
325 0.58
326 0.65
327 0.69
328 0.77
329 0.8