Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MV07

Protein Details
Accession A0A4S4MV07    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
156-183PRKPTATTKLGKKAKRKKEKELLAYLGPHydrophilic
NLS Segment(s)
PositionSequence
145-175PPPILEREHRLPRKPTATTKLGKKAKRKKEK
Subcellular Location(s) nucl 15.5, mito_nucl 9.5, cyto 4, pero 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MVTPGPETPATSVSPPHPDLSQAAMTEQVRMISKQLRLEGKLKPPPTYRWSLAAKEPAVSNWGSIDIGPSGSTSVIQQTREDVDMNEVHDDSDVDMTDPALAHAVVVPPQPKQHTYKKPWPISSIIPNYFVIFRDHEAWNRIKPPPPILEREHRLPRKPTATTKLGKKAKRKKEKELLAYLGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.25
5 0.25
6 0.25
7 0.27
8 0.26
9 0.2
10 0.19
11 0.22
12 0.22
13 0.21
14 0.2
15 0.17
16 0.16
17 0.16
18 0.19
19 0.2
20 0.23
21 0.25
22 0.31
23 0.33
24 0.35
25 0.39
26 0.42
27 0.46
28 0.5
29 0.48
30 0.49
31 0.49
32 0.51
33 0.53
34 0.53
35 0.46
36 0.45
37 0.47
38 0.44
39 0.45
40 0.45
41 0.39
42 0.33
43 0.31
44 0.25
45 0.23
46 0.2
47 0.15
48 0.09
49 0.09
50 0.08
51 0.07
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.06
60 0.05
61 0.09
62 0.11
63 0.12
64 0.12
65 0.13
66 0.14
67 0.15
68 0.15
69 0.11
70 0.12
71 0.12
72 0.12
73 0.12
74 0.1
75 0.09
76 0.09
77 0.09
78 0.06
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.05
93 0.07
94 0.08
95 0.08
96 0.11
97 0.13
98 0.16
99 0.22
100 0.31
101 0.39
102 0.47
103 0.56
104 0.64
105 0.69
106 0.68
107 0.66
108 0.6
109 0.54
110 0.55
111 0.52
112 0.44
113 0.39
114 0.37
115 0.35
116 0.32
117 0.28
118 0.21
119 0.16
120 0.16
121 0.18
122 0.19
123 0.21
124 0.25
125 0.28
126 0.29
127 0.32
128 0.34
129 0.36
130 0.38
131 0.41
132 0.44
133 0.46
134 0.47
135 0.49
136 0.54
137 0.54
138 0.6
139 0.64
140 0.63
141 0.65
142 0.65
143 0.67
144 0.66
145 0.66
146 0.66
147 0.64
148 0.65
149 0.65
150 0.69
151 0.71
152 0.72
153 0.73
154 0.76
155 0.78
156 0.81
157 0.85
158 0.85
159 0.85
160 0.87
161 0.9
162 0.88
163 0.86