Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MA44

Protein Details
Accession A0A4S4MA44    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
147-167ENTDSDKRPKKPPQIGKDIVRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_mito 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MEKTTFLSLDVGKVAKLARGRLKAASLDADSLSDAHKNNRPLLQVRDVAECKYSLVAVSPERLTSPEFWKILECELLRKSLVLYAIDEAHVIVPWSKLFRKDYGNISKACTRIPLIVPLLAMTATSQQGEPETNLVRLLVRKEWEAENTDSDKRPKKPPQIGKDIVRAAQVVLLDAVGMMGRVAGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.24
5 0.29
6 0.34
7 0.36
8 0.37
9 0.4
10 0.38
11 0.37
12 0.34
13 0.26
14 0.23
15 0.21
16 0.18
17 0.16
18 0.14
19 0.13
20 0.12
21 0.13
22 0.16
23 0.21
24 0.24
25 0.28
26 0.31
27 0.35
28 0.36
29 0.41
30 0.42
31 0.41
32 0.39
33 0.42
34 0.4
35 0.36
36 0.33
37 0.27
38 0.21
39 0.17
40 0.15
41 0.08
42 0.09
43 0.1
44 0.1
45 0.13
46 0.12
47 0.12
48 0.13
49 0.14
50 0.14
51 0.14
52 0.17
53 0.21
54 0.2
55 0.2
56 0.21
57 0.21
58 0.21
59 0.22
60 0.18
61 0.16
62 0.17
63 0.18
64 0.17
65 0.16
66 0.15
67 0.12
68 0.13
69 0.1
70 0.09
71 0.09
72 0.09
73 0.09
74 0.09
75 0.07
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.05
82 0.07
83 0.08
84 0.12
85 0.14
86 0.17
87 0.21
88 0.24
89 0.32
90 0.38
91 0.41
92 0.38
93 0.39
94 0.4
95 0.36
96 0.33
97 0.26
98 0.19
99 0.18
100 0.18
101 0.19
102 0.17
103 0.17
104 0.16
105 0.15
106 0.14
107 0.11
108 0.09
109 0.06
110 0.06
111 0.06
112 0.07
113 0.07
114 0.07
115 0.08
116 0.09
117 0.09
118 0.11
119 0.12
120 0.12
121 0.12
122 0.12
123 0.13
124 0.14
125 0.16
126 0.17
127 0.17
128 0.18
129 0.2
130 0.22
131 0.24
132 0.26
133 0.25
134 0.27
135 0.29
136 0.32
137 0.33
138 0.38
139 0.43
140 0.44
141 0.52
142 0.57
143 0.63
144 0.7
145 0.77
146 0.78
147 0.81
148 0.84
149 0.8
150 0.78
151 0.71
152 0.62
153 0.53
154 0.44
155 0.34
156 0.28
157 0.22
158 0.14
159 0.11
160 0.09
161 0.07
162 0.06
163 0.06
164 0.04
165 0.04
166 0.03