Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4MU53

Protein Details
Accession A0A4S4MU53    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-72PNRGQEPKKRSKKVPAEKPABasic
NLS Segment(s)
PositionSequence
58-72EPKKRSKKVPAEKPA
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MYRLGSGGKRAPSLYNKYVAENLKTWREANPDRPVKEAMSAVAAQWRDAPENPNRGQEPKKRSKKVPAEKPAAATRTTRKTAATGDAEPAEDAEAEADADVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.42
4 0.42
5 0.47
6 0.44
7 0.4
8 0.35
9 0.35
10 0.34
11 0.34
12 0.33
13 0.3
14 0.35
15 0.36
16 0.4
17 0.46
18 0.48
19 0.47
20 0.49
21 0.48
22 0.4
23 0.38
24 0.31
25 0.21
26 0.16
27 0.15
28 0.12
29 0.13
30 0.13
31 0.11
32 0.12
33 0.12
34 0.11
35 0.12
36 0.15
37 0.16
38 0.23
39 0.24
40 0.26
41 0.27
42 0.29
43 0.35
44 0.4
45 0.45
46 0.5
47 0.59
48 0.61
49 0.66
50 0.72
51 0.76
52 0.79
53 0.8
54 0.79
55 0.76
56 0.71
57 0.7
58 0.65
59 0.56
60 0.47
61 0.4
62 0.38
63 0.38
64 0.39
65 0.36
66 0.32
67 0.32
68 0.34
69 0.36
70 0.34
71 0.28
72 0.28
73 0.28
74 0.27
75 0.25
76 0.22
77 0.16
78 0.11
79 0.1
80 0.07
81 0.06
82 0.06