Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3XEF9

Protein Details
Accession A0A4V3XEF9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MYAVRRLRSKFPKYGQRVTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004255  O-acyltransferase_WSD1_N  
Gene Ontology GO:0004144  F:diacylglycerol O-acyltransferase activity  
GO:0045017  P:glycerolipid biosynthetic process  
Pfam View protein in Pfam  
PF03007  WES_acyltransf  
Amino Acid Sequences MYAVRRLRSKFPKYGQRVTSVGRKFHGARFEDDPYFDVNNHVRTIRLPEPAGKAELDELMGDFIAQDWDLSRPLWEMALVENYRDEEGAKCAIISRGHHTLADGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.74
3 0.69
4 0.64
5 0.59
6 0.59
7 0.53
8 0.48
9 0.4
10 0.41
11 0.38
12 0.39
13 0.42
14 0.35
15 0.34
16 0.36
17 0.39
18 0.35
19 0.33
20 0.3
21 0.25
22 0.24
23 0.2
24 0.18
25 0.17
26 0.18
27 0.18
28 0.17
29 0.15
30 0.14
31 0.21
32 0.2
33 0.21
34 0.19
35 0.21
36 0.24
37 0.25
38 0.25
39 0.19
40 0.16
41 0.13
42 0.12
43 0.1
44 0.06
45 0.05
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.05
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.07
64 0.08
65 0.15
66 0.14
67 0.14
68 0.14
69 0.15
70 0.15
71 0.15
72 0.15
73 0.09
74 0.12
75 0.13
76 0.12
77 0.11
78 0.13
79 0.16
80 0.19
81 0.21
82 0.25
83 0.28
84 0.3
85 0.3