Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4M4V4

Protein Details
Accession A0A4S4M4V4   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
136-155KVLACRFITPRRKQKVNNFTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences SYAGRISFSSDTWTSPNHRSYMAILAHLEHEGQPLVLLLDLSEVPFSHTGAALLQVMQRTVLEFGIATKVLTFTGDNATNNDTLCEEWHKLNLHFLGEESRIRCILHTESLAARIIIKQFDVLPGTSTIDQDDTEKVLACRFITPRRKQKVNNFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.35
4 0.31
5 0.31
6 0.3
7 0.31
8 0.34
9 0.3
10 0.26
11 0.22
12 0.21
13 0.21
14 0.2
15 0.18
16 0.11
17 0.11
18 0.09
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.05
25 0.04
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.07
32 0.08
33 0.08
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.07
53 0.07
54 0.06
55 0.05
56 0.06
57 0.05
58 0.06
59 0.06
60 0.05
61 0.08
62 0.1
63 0.1
64 0.11
65 0.12
66 0.12
67 0.12
68 0.12
69 0.09
70 0.07
71 0.08
72 0.1
73 0.1
74 0.1
75 0.14
76 0.16
77 0.15
78 0.19
79 0.19
80 0.16
81 0.15
82 0.15
83 0.14
84 0.14
85 0.17
86 0.14
87 0.14
88 0.14
89 0.14
90 0.14
91 0.15
92 0.15
93 0.16
94 0.16
95 0.16
96 0.16
97 0.18
98 0.18
99 0.15
100 0.13
101 0.12
102 0.13
103 0.11
104 0.11
105 0.1
106 0.1
107 0.13
108 0.14
109 0.12
110 0.12
111 0.13
112 0.16
113 0.15
114 0.15
115 0.14
116 0.13
117 0.14
118 0.13
119 0.14
120 0.12
121 0.13
122 0.14
123 0.14
124 0.15
125 0.16
126 0.15
127 0.19
128 0.23
129 0.32
130 0.41
131 0.51
132 0.6
133 0.68
134 0.76
135 0.8