Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MU50

Protein Details
Accession A0A4S4MU50   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
197-218ASPTPAQRRRTNPRNHQRVPSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MAAVPVNPLRAQPALDRPSDSNLFDPFVVHPSQDNESPEPSIALNGSTTPSTFRAPPELATRPTGRLARRRQNADDTPSTPTPTRPVPVPRTSGRSAAGTQPLSRSVPVPANVPHRNHRPNNRRARTGPAVAAVAWDFPICXDSDDVTPPSTPIRESASVPSKQASEVTWQQQALRIDEPPRTAPLSATFKFPATQAASPTPAQRRRTNPRNHQRVPSEGMFAMSADEDSSSSDAAEELKALVGLFPKRREVPSRRTPSPVGDARVLPAGFYAGSVYQNSPSPDELPVPAFKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.37
4 0.35
5 0.41
6 0.42
7 0.38
8 0.31
9 0.29
10 0.29
11 0.25
12 0.25
13 0.19
14 0.2
15 0.19
16 0.16
17 0.16
18 0.18
19 0.22
20 0.24
21 0.27
22 0.26
23 0.27
24 0.28
25 0.26
26 0.24
27 0.2
28 0.18
29 0.14
30 0.12
31 0.1
32 0.09
33 0.11
34 0.1
35 0.1
36 0.12
37 0.13
38 0.15
39 0.16
40 0.18
41 0.22
42 0.23
43 0.25
44 0.3
45 0.33
46 0.33
47 0.36
48 0.36
49 0.32
50 0.36
51 0.39
52 0.38
53 0.42
54 0.5
55 0.55
56 0.62
57 0.66
58 0.65
59 0.69
60 0.69
61 0.67
62 0.62
63 0.54
64 0.52
65 0.46
66 0.44
67 0.36
68 0.31
69 0.28
70 0.26
71 0.25
72 0.24
73 0.31
74 0.35
75 0.39
76 0.44
77 0.43
78 0.47
79 0.47
80 0.45
81 0.38
82 0.33
83 0.3
84 0.28
85 0.3
86 0.25
87 0.24
88 0.22
89 0.23
90 0.21
91 0.2
92 0.17
93 0.14
94 0.17
95 0.17
96 0.18
97 0.2
98 0.27
99 0.32
100 0.34
101 0.38
102 0.44
103 0.51
104 0.55
105 0.62
106 0.64
107 0.69
108 0.77
109 0.76
110 0.73
111 0.67
112 0.68
113 0.62
114 0.55
115 0.46
116 0.36
117 0.31
118 0.24
119 0.23
120 0.14
121 0.09
122 0.07
123 0.06
124 0.04
125 0.04
126 0.05
127 0.05
128 0.05
129 0.06
130 0.07
131 0.1
132 0.11
133 0.13
134 0.12
135 0.11
136 0.12
137 0.12
138 0.11
139 0.1
140 0.12
141 0.12
142 0.14
143 0.19
144 0.24
145 0.25
146 0.25
147 0.25
148 0.21
149 0.2
150 0.19
151 0.15
152 0.14
153 0.17
154 0.2
155 0.21
156 0.21
157 0.21
158 0.25
159 0.26
160 0.23
161 0.19
162 0.19
163 0.18
164 0.2
165 0.22
166 0.19
167 0.19
168 0.18
169 0.17
170 0.16
171 0.2
172 0.26
173 0.24
174 0.27
175 0.25
176 0.25
177 0.25
178 0.24
179 0.23
180 0.2
181 0.2
182 0.2
183 0.21
184 0.23
185 0.24
186 0.29
187 0.32
188 0.36
189 0.4
190 0.44
191 0.51
192 0.59
193 0.68
194 0.73
195 0.76
196 0.79
197 0.85
198 0.83
199 0.82
200 0.76
201 0.71
202 0.67
203 0.57
204 0.5
205 0.39
206 0.35
207 0.27
208 0.22
209 0.17
210 0.11
211 0.09
212 0.06
213 0.06
214 0.05
215 0.06
216 0.07
217 0.06
218 0.06
219 0.06
220 0.06
221 0.07
222 0.07
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.07
229 0.1
230 0.16
231 0.21
232 0.23
233 0.29
234 0.32
235 0.37
236 0.46
237 0.5
238 0.54
239 0.6
240 0.66
241 0.65
242 0.67
243 0.65
244 0.61
245 0.62
246 0.58
247 0.52
248 0.46
249 0.43
250 0.39
251 0.42
252 0.36
253 0.27
254 0.21
255 0.17
256 0.13
257 0.13
258 0.13
259 0.08
260 0.1
261 0.12
262 0.14
263 0.15
264 0.19
265 0.21
266 0.22
267 0.23
268 0.23
269 0.23
270 0.24
271 0.24
272 0.24