Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LS48

Protein Details
Accession A0A4S4LS48   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
103-131SALHDNKRGRTKKKEKKEKGRGGRKIDLVBasic
NLS Segment(s)
PositionSequence
108-127NKRGRTKKKEKKEKGRGGRK
Subcellular Location(s) cyto_nucl 12.833, nucl 11, cyto 10.5, cyto_pero 8.332, pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR025700  Lys/Orn_oxygenase  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
GO:0044249  P:cellular biosynthetic process  
GO:1901566  P:organonitrogen compound biosynthetic process  
Pfam View protein in Pfam  
PF13434  Lys_Orn_oxgnase  
Amino Acid Sequences MLIHSPSDSEYYTIGKLDSPNDLVYCSLRDAEMIQAEQTEVFPTWMSGYFCNHKPIVRAAFEATSLAAFCSGIVIEWDANEASDPSYYSQGNPSGDHVSGRGSALHDNKRGRTKKKEKKEKGRGGRKIDLVPADGLNHMHALTTLHGTFSREEISDVESTKDHRYWRRNGQGCAPDINTHWYSLSTDLNPDWDQTHVFQPELKAYWKGLVEKYDIVGNVRLHTKVVGATWDNRRQLYCVQLHDVQSGRKWTEEAQAIVSATGVVDVPYYPEELKGIYESFKGEHFHSARWNHSVDLQNKRVAVIGNGCSASQFVPVIAADPTTQIVSFCRTPNWLLPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.18
4 0.18
5 0.21
6 0.21
7 0.22
8 0.22
9 0.22
10 0.2
11 0.2
12 0.19
13 0.17
14 0.15
15 0.13
16 0.13
17 0.13
18 0.16
19 0.18
20 0.16
21 0.15
22 0.15
23 0.15
24 0.15
25 0.14
26 0.12
27 0.09
28 0.09
29 0.09
30 0.09
31 0.11
32 0.14
33 0.15
34 0.15
35 0.2
36 0.25
37 0.28
38 0.33
39 0.32
40 0.31
41 0.32
42 0.38
43 0.39
44 0.35
45 0.34
46 0.32
47 0.31
48 0.29
49 0.27
50 0.19
51 0.13
52 0.11
53 0.09
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.05
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.06
70 0.07
71 0.08
72 0.08
73 0.11
74 0.11
75 0.12
76 0.15
77 0.19
78 0.2
79 0.19
80 0.21
81 0.21
82 0.21
83 0.2
84 0.17
85 0.15
86 0.14
87 0.14
88 0.12
89 0.11
90 0.15
91 0.22
92 0.27
93 0.32
94 0.34
95 0.39
96 0.48
97 0.55
98 0.57
99 0.62
100 0.68
101 0.72
102 0.79
103 0.86
104 0.87
105 0.9
106 0.94
107 0.94
108 0.93
109 0.94
110 0.91
111 0.87
112 0.83
113 0.75
114 0.65
115 0.58
116 0.48
117 0.39
118 0.31
119 0.23
120 0.18
121 0.15
122 0.13
123 0.1
124 0.09
125 0.07
126 0.06
127 0.06
128 0.06
129 0.06
130 0.08
131 0.08
132 0.08
133 0.08
134 0.1
135 0.1
136 0.1
137 0.11
138 0.09
139 0.1
140 0.1
141 0.12
142 0.12
143 0.12
144 0.12
145 0.11
146 0.13
147 0.15
148 0.17
149 0.19
150 0.25
151 0.31
152 0.37
153 0.46
154 0.53
155 0.57
156 0.56
157 0.58
158 0.56
159 0.51
160 0.46
161 0.38
162 0.29
163 0.24
164 0.27
165 0.2
166 0.16
167 0.15
168 0.13
169 0.13
170 0.13
171 0.14
172 0.1
173 0.11
174 0.1
175 0.13
176 0.13
177 0.13
178 0.11
179 0.1
180 0.11
181 0.11
182 0.16
183 0.13
184 0.13
185 0.14
186 0.14
187 0.16
188 0.17
189 0.17
190 0.14
191 0.13
192 0.16
193 0.17
194 0.19
195 0.19
196 0.19
197 0.2
198 0.19
199 0.19
200 0.18
201 0.16
202 0.15
203 0.17
204 0.16
205 0.15
206 0.17
207 0.16
208 0.15
209 0.15
210 0.14
211 0.1
212 0.1
213 0.12
214 0.12
215 0.18
216 0.25
217 0.32
218 0.33
219 0.33
220 0.34
221 0.33
222 0.33
223 0.35
224 0.31
225 0.27
226 0.3
227 0.33
228 0.33
229 0.34
230 0.34
231 0.28
232 0.27
233 0.29
234 0.25
235 0.22
236 0.21
237 0.2
238 0.25
239 0.27
240 0.25
241 0.22
242 0.23
243 0.22
244 0.21
245 0.19
246 0.12
247 0.08
248 0.07
249 0.05
250 0.04
251 0.04
252 0.04
253 0.06
254 0.06
255 0.08
256 0.08
257 0.09
258 0.09
259 0.09
260 0.11
261 0.11
262 0.11
263 0.11
264 0.12
265 0.13
266 0.14
267 0.16
268 0.17
269 0.16
270 0.24
271 0.25
272 0.26
273 0.33
274 0.37
275 0.38
276 0.4
277 0.4
278 0.32
279 0.37
280 0.43
281 0.42
282 0.48
283 0.48
284 0.47
285 0.46
286 0.45
287 0.41
288 0.33
289 0.29
290 0.26
291 0.24
292 0.25
293 0.25
294 0.24
295 0.22
296 0.22
297 0.19
298 0.15
299 0.12
300 0.08
301 0.09
302 0.1
303 0.11
304 0.1
305 0.11
306 0.09
307 0.1
308 0.11
309 0.11
310 0.11
311 0.1
312 0.12
313 0.16
314 0.2
315 0.21
316 0.23
317 0.25
318 0.29