Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MVZ0

Protein Details
Accession A0A4S4MVZ0    Localization Confidence High Confidence Score 21.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-47LARASSSSGAPKKKKRKTGTSSSATAHydrophilic
245-266AAFLTKKRTKGPRKPEYSGPPPHydrophilic
284-307RGNGWEKKLFQRQNEKKRRGAESYHydrophilic
NLS Segment(s)
PositionSequence
31-38APKKKKRK
178-211EAARKKREREELEAKKMEWGKGLVQRDEAEKKKK
250-266KKRTKGPRKPEYSGPPP
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MADMKAYLAAKYMSGPKADAILARASSSSGAPKKKKRKTGTSSSATASTSFIKDDDATDWGAMAKAPEEEDDDGDVVMASDRAFRKRQKIEGGSGWATVRDAEEPPADEVPADEQPQVVAEPAEEFKGGLMTAEQLKKKFGKKAVKHDMTEEEIAAAQETVYRDTSGRKVDTAAEKAEAARKKREREELEAKKMEWGKGLVQRDEAEKKKKELEELKSRPFARTIDDAAMNEDLKAQDRWNDPAAAFLTKKRTKGPRKPEYSGPPPPPNRFGIRPGYRWDGVDRGNGWEKKLFQRQNEKKRRGAESYQWSVDEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.21
4 0.23
5 0.24
6 0.22
7 0.17
8 0.19
9 0.18
10 0.18
11 0.17
12 0.15
13 0.15
14 0.15
15 0.22
16 0.25
17 0.34
18 0.42
19 0.53
20 0.63
21 0.72
22 0.81
23 0.82
24 0.86
25 0.86
26 0.88
27 0.88
28 0.83
29 0.77
30 0.7
31 0.62
32 0.52
33 0.43
34 0.34
35 0.27
36 0.21
37 0.18
38 0.15
39 0.14
40 0.14
41 0.15
42 0.15
43 0.14
44 0.14
45 0.13
46 0.13
47 0.11
48 0.11
49 0.09
50 0.08
51 0.07
52 0.07
53 0.07
54 0.08
55 0.11
56 0.11
57 0.12
58 0.13
59 0.12
60 0.11
61 0.11
62 0.1
63 0.07
64 0.06
65 0.05
66 0.04
67 0.09
68 0.11
69 0.16
70 0.21
71 0.26
72 0.35
73 0.41
74 0.48
75 0.53
76 0.55
77 0.57
78 0.56
79 0.57
80 0.49
81 0.44
82 0.37
83 0.27
84 0.23
85 0.18
86 0.14
87 0.1
88 0.09
89 0.1
90 0.11
91 0.12
92 0.13
93 0.13
94 0.13
95 0.11
96 0.1
97 0.11
98 0.12
99 0.12
100 0.1
101 0.1
102 0.1
103 0.1
104 0.1
105 0.08
106 0.05
107 0.04
108 0.06
109 0.06
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.04
117 0.04
118 0.05
119 0.09
120 0.13
121 0.15
122 0.15
123 0.19
124 0.23
125 0.27
126 0.32
127 0.36
128 0.43
129 0.48
130 0.58
131 0.66
132 0.67
133 0.64
134 0.61
135 0.55
136 0.48
137 0.41
138 0.3
139 0.19
140 0.14
141 0.13
142 0.1
143 0.07
144 0.04
145 0.05
146 0.06
147 0.07
148 0.07
149 0.07
150 0.08
151 0.1
152 0.13
153 0.15
154 0.16
155 0.15
156 0.15
157 0.18
158 0.22
159 0.22
160 0.2
161 0.17
162 0.17
163 0.17
164 0.22
165 0.23
166 0.22
167 0.29
168 0.34
169 0.39
170 0.44
171 0.53
172 0.52
173 0.56
174 0.64
175 0.64
176 0.66
177 0.63
178 0.57
179 0.53
180 0.51
181 0.42
182 0.33
183 0.26
184 0.22
185 0.26
186 0.3
187 0.25
188 0.25
189 0.25
190 0.28
191 0.34
192 0.36
193 0.38
194 0.37
195 0.4
196 0.45
197 0.45
198 0.48
199 0.49
200 0.52
201 0.55
202 0.59
203 0.62
204 0.62
205 0.62
206 0.55
207 0.49
208 0.41
209 0.34
210 0.31
211 0.28
212 0.24
213 0.25
214 0.24
215 0.24
216 0.24
217 0.2
218 0.16
219 0.15
220 0.12
221 0.12
222 0.13
223 0.12
224 0.17
225 0.19
226 0.23
227 0.24
228 0.25
229 0.23
230 0.26
231 0.27
232 0.24
233 0.23
234 0.23
235 0.31
236 0.33
237 0.35
238 0.4
239 0.49
240 0.56
241 0.66
242 0.73
243 0.73
244 0.78
245 0.81
246 0.82
247 0.81
248 0.79
249 0.78
250 0.75
251 0.75
252 0.73
253 0.74
254 0.69
255 0.64
256 0.62
257 0.56
258 0.53
259 0.54
260 0.53
261 0.52
262 0.53
263 0.55
264 0.5
265 0.48
266 0.45
267 0.4
268 0.36
269 0.38
270 0.33
271 0.33
272 0.41
273 0.4
274 0.4
275 0.39
276 0.41
277 0.45
278 0.54
279 0.55
280 0.54
281 0.65
282 0.73
283 0.79
284 0.86
285 0.84
286 0.81
287 0.82
288 0.81
289 0.77
290 0.75
291 0.73
292 0.73
293 0.73
294 0.69