Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V3XIS1

Protein Details
Accession A0A4V3XIS1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
290-309RSLGHFEKPKPRPRDRLDDEBasic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 3, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045340  DUF6533  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20151  DUF6533  
Amino Acid Sequences MVTKSHSFDNILTNNGAAYLRVGSLAVAMYDYVLTLPAEWRFYRIQKSWKLSAGCIMFILLRYISVITLIVSEIGYFHHFTFDQCRQYYLVAPVFKALQTLISQIIMAFRTYNISQRAEWLRYALPIIVVVTSSMEFFTNLFARSMVQGTIGQLAVTNCTGGNVDHKSVWIFYLISMLYDFFTMGVSSYYLMRSTSSMFRMSGLVRVLFYDGIGYFLCLTAVNIVNLILYRASDVETQSSGASLGYTVTWIMSQKILIHLRDAAEDAHTYSAHAVTRELTSARDITRAMRSLGHFEKPKPRPRDRLDDEYDLGSPSNSPADGFSEQTENELDVKVQVEHSVKVDYDPHAYDRETYLKQKTSQGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.12
5 0.11
6 0.09
7 0.09
8 0.09
9 0.09
10 0.08
11 0.08
12 0.08
13 0.07
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.05
21 0.05
22 0.06
23 0.09
24 0.11
25 0.15
26 0.15
27 0.19
28 0.23
29 0.29
30 0.36
31 0.4
32 0.47
33 0.52
34 0.59
35 0.61
36 0.63
37 0.6
38 0.53
39 0.53
40 0.46
41 0.37
42 0.3
43 0.25
44 0.18
45 0.16
46 0.17
47 0.1
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.05
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.08
63 0.09
64 0.09
65 0.11
66 0.12
67 0.13
68 0.21
69 0.26
70 0.31
71 0.3
72 0.31
73 0.3
74 0.31
75 0.33
76 0.31
77 0.31
78 0.25
79 0.24
80 0.24
81 0.24
82 0.22
83 0.19
84 0.14
85 0.1
86 0.09
87 0.11
88 0.1
89 0.1
90 0.1
91 0.09
92 0.11
93 0.09
94 0.09
95 0.08
96 0.07
97 0.11
98 0.11
99 0.17
100 0.19
101 0.2
102 0.2
103 0.26
104 0.31
105 0.29
106 0.29
107 0.26
108 0.23
109 0.21
110 0.22
111 0.16
112 0.11
113 0.09
114 0.09
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.09
131 0.1
132 0.11
133 0.09
134 0.08
135 0.08
136 0.08
137 0.1
138 0.09
139 0.08
140 0.08
141 0.08
142 0.08
143 0.08
144 0.07
145 0.06
146 0.06
147 0.07
148 0.05
149 0.1
150 0.1
151 0.11
152 0.11
153 0.12
154 0.12
155 0.12
156 0.12
157 0.08
158 0.07
159 0.06
160 0.08
161 0.07
162 0.07
163 0.07
164 0.07
165 0.06
166 0.06
167 0.06
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.06
179 0.06
180 0.06
181 0.09
182 0.11
183 0.12
184 0.13
185 0.13
186 0.14
187 0.15
188 0.15
189 0.15
190 0.13
191 0.12
192 0.1
193 0.11
194 0.11
195 0.09
196 0.08
197 0.07
198 0.05
199 0.06
200 0.06
201 0.06
202 0.05
203 0.06
204 0.06
205 0.05
206 0.05
207 0.06
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.04
216 0.04
217 0.04
218 0.04
219 0.06
220 0.07
221 0.08
222 0.09
223 0.1
224 0.1
225 0.1
226 0.1
227 0.08
228 0.07
229 0.06
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.05
237 0.06
238 0.06
239 0.07
240 0.07
241 0.08
242 0.15
243 0.19
244 0.18
245 0.19
246 0.2
247 0.2
248 0.21
249 0.21
250 0.14
251 0.12
252 0.12
253 0.11
254 0.11
255 0.1
256 0.1
257 0.09
258 0.11
259 0.11
260 0.11
261 0.1
262 0.11
263 0.12
264 0.13
265 0.13
266 0.12
267 0.13
268 0.15
269 0.16
270 0.16
271 0.16
272 0.18
273 0.23
274 0.24
275 0.23
276 0.24
277 0.25
278 0.31
279 0.34
280 0.38
281 0.36
282 0.4
283 0.49
284 0.53
285 0.62
286 0.64
287 0.69
288 0.72
289 0.75
290 0.81
291 0.78
292 0.79
293 0.76
294 0.72
295 0.66
296 0.57
297 0.5
298 0.4
299 0.32
300 0.23
301 0.16
302 0.12
303 0.12
304 0.1
305 0.09
306 0.1
307 0.15
308 0.16
309 0.17
310 0.18
311 0.19
312 0.19
313 0.2
314 0.2
315 0.16
316 0.15
317 0.15
318 0.13
319 0.11
320 0.13
321 0.12
322 0.12
323 0.16
324 0.17
325 0.18
326 0.2
327 0.21
328 0.2
329 0.21
330 0.24
331 0.22
332 0.24
333 0.25
334 0.26
335 0.26
336 0.27
337 0.27
338 0.28
339 0.32
340 0.33
341 0.37
342 0.42
343 0.45
344 0.48