Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4LY75

Protein Details
Accession A0A4S4LY75    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-37TTKTTKRKAADKSEKSTKKAKKDKNAPKRALSAHydrophilic
NLS Segment(s)
PositionSequence
9-33TKRKAADKSEKSTKKAKKDKNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTKTTKRKAADKSEKSTKKAKKDKNAPKRALSAYMFFSQDWRERIKAENPDAGFGEIGKLLGAKWKELDDEEKKPYNEQAARDKTRAEQEKSEYDGKKADSASGGDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.77
4 0.8
5 0.8
6 0.76
7 0.77
8 0.74
9 0.73
10 0.75
11 0.76
12 0.76
13 0.81
14 0.88
15 0.89
16 0.91
17 0.86
18 0.81
19 0.77
20 0.69
21 0.64
22 0.54
23 0.45
24 0.38
25 0.35
26 0.31
27 0.24
28 0.23
29 0.2
30 0.22
31 0.21
32 0.21
33 0.19
34 0.19
35 0.23
36 0.28
37 0.31
38 0.3
39 0.33
40 0.3
41 0.3
42 0.29
43 0.26
44 0.2
45 0.13
46 0.11
47 0.06
48 0.06
49 0.04
50 0.04
51 0.03
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.11
58 0.12
59 0.2
60 0.21
61 0.26
62 0.31
63 0.35
64 0.35
65 0.36
66 0.36
67 0.37
68 0.36
69 0.35
70 0.4
71 0.44
72 0.49
73 0.48
74 0.48
75 0.43
76 0.5
77 0.53
78 0.47
79 0.44
80 0.45
81 0.49
82 0.53
83 0.57
84 0.48
85 0.43
86 0.42
87 0.38
88 0.37
89 0.32
90 0.29
91 0.23
92 0.23
93 0.24
94 0.22