Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MU79

Protein Details
Accession A0A4S4MU79    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
99-122GQGEKVRLRKENRKKIRDVQFMKTHydrophilic
NLS Segment(s)
PositionSequence
105-113RLRKENRKK
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSFLSALRRPPAAVRLNASYRATPCRSVSTSIPAASDKPAKASATATHTISSCTEGTVLGGLNWLKGQAPVTALADEEYPPWLWKLLDPKVIPDDGPGGQGEKVRLRKENRKKIRDVQFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.42
4 0.46
5 0.44
6 0.39
7 0.36
8 0.4
9 0.38
10 0.35
11 0.34
12 0.35
13 0.35
14 0.36
15 0.35
16 0.34
17 0.34
18 0.31
19 0.3
20 0.25
21 0.24
22 0.23
23 0.26
24 0.19
25 0.19
26 0.21
27 0.2
28 0.2
29 0.2
30 0.2
31 0.21
32 0.23
33 0.21
34 0.2
35 0.19
36 0.2
37 0.18
38 0.18
39 0.12
40 0.1
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.08
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.08
71 0.11
72 0.18
73 0.21
74 0.28
75 0.28
76 0.3
77 0.33
78 0.33
79 0.3
80 0.24
81 0.22
82 0.16
83 0.17
84 0.14
85 0.12
86 0.13
87 0.15
88 0.17
89 0.22
90 0.28
91 0.31
92 0.39
93 0.46
94 0.56
95 0.65
96 0.73
97 0.76
98 0.79
99 0.83
100 0.85
101 0.88
102 0.88
103 0.82