Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4M0J4

Protein Details
Accession A0A4S4M0J4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
126-155SSHLPAPEPKRLRKRKTRKRIIRPVLDVDPBasic
NLS Segment(s)
PositionSequence
133-147EPKRLRKRKTRKRII
Subcellular Location(s) nucl 10, mito 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MTTAIEQAISHLIQTRQPITVSHVLPIYLQFAGLSSMADLDSMTAIITFERAMDKHPAPSYPIAKRDKTKMVTLAPLPCKRLYHAEVEQLRRDYWEKAIELGSTFGLCNCVGCGRLLDIPSREDLSSHLPAPEPKRLRKRKTRKRIIRPVLDVDPYGASTSARCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.23
5 0.24
6 0.26
7 0.32
8 0.29
9 0.27
10 0.26
11 0.24
12 0.24
13 0.23
14 0.19
15 0.11
16 0.11
17 0.08
18 0.08
19 0.09
20 0.08
21 0.08
22 0.05
23 0.06
24 0.06
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.06
38 0.06
39 0.09
40 0.14
41 0.15
42 0.2
43 0.21
44 0.21
45 0.22
46 0.27
47 0.31
48 0.3
49 0.37
50 0.37
51 0.4
52 0.43
53 0.45
54 0.48
55 0.45
56 0.43
57 0.39
58 0.36
59 0.36
60 0.35
61 0.36
62 0.35
63 0.35
64 0.34
65 0.31
66 0.3
67 0.28
68 0.31
69 0.26
70 0.25
71 0.25
72 0.3
73 0.34
74 0.36
75 0.37
76 0.33
77 0.31
78 0.27
79 0.27
80 0.2
81 0.18
82 0.19
83 0.17
84 0.17
85 0.17
86 0.16
87 0.14
88 0.14
89 0.11
90 0.08
91 0.08
92 0.06
93 0.07
94 0.07
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.08
101 0.08
102 0.11
103 0.12
104 0.14
105 0.15
106 0.16
107 0.17
108 0.19
109 0.17
110 0.15
111 0.16
112 0.19
113 0.2
114 0.2
115 0.19
116 0.19
117 0.24
118 0.29
119 0.36
120 0.37
121 0.43
122 0.54
123 0.63
124 0.72
125 0.78
126 0.85
127 0.87
128 0.92
129 0.94
130 0.94
131 0.95
132 0.96
133 0.95
134 0.94
135 0.89
136 0.84
137 0.78
138 0.7
139 0.59
140 0.49
141 0.4
142 0.31
143 0.26
144 0.19
145 0.13