Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LP28

Protein Details
Accession A0A4S4LP28   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-53KVRTAMSKRFKQRSKGKVARHydrophilic
NLS Segment(s)
PositionSequence
36-50RTAMSKRFKQRSKGK
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00270  DEAD  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
Amino Acid Sequences MPPANVRDHKSAQALSKANLARARLAKRGYDSSKVRTAMSKRFKQRSKGKVAREWQLDAAESILLGLDAVVLAGTGTGKTAAYMLPLLLPETAGKVLIVIEPLVALQRDQVRRFKKMGIPALAVNSKNWSEKKAKDIKDLKYRALFIGPEMAIEHAGGRSLIADAPDGLLNAEVVIRKNHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.39
3 0.43
4 0.4
5 0.4
6 0.39
7 0.36
8 0.34
9 0.38
10 0.42
11 0.4
12 0.42
13 0.4
14 0.42
15 0.49
16 0.47
17 0.49
18 0.49
19 0.48
20 0.52
21 0.5
22 0.46
23 0.45
24 0.46
25 0.47
26 0.53
27 0.56
28 0.58
29 0.67
30 0.72
31 0.75
32 0.8
33 0.79
34 0.8
35 0.8
36 0.78
37 0.77
38 0.76
39 0.74
40 0.68
41 0.6
42 0.51
43 0.44
44 0.36
45 0.27
46 0.22
47 0.14
48 0.09
49 0.07
50 0.05
51 0.04
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.05
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.04
87 0.04
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.06
94 0.12
95 0.16
96 0.19
97 0.27
98 0.31
99 0.35
100 0.37
101 0.39
102 0.38
103 0.42
104 0.46
105 0.42
106 0.4
107 0.37
108 0.39
109 0.37
110 0.33
111 0.26
112 0.22
113 0.2
114 0.23
115 0.23
116 0.24
117 0.27
118 0.3
119 0.39
120 0.45
121 0.47
122 0.52
123 0.59
124 0.63
125 0.68
126 0.68
127 0.63
128 0.59
129 0.57
130 0.48
131 0.43
132 0.34
133 0.25
134 0.28
135 0.22
136 0.18
137 0.17
138 0.16
139 0.13
140 0.13
141 0.13
142 0.06
143 0.07
144 0.06
145 0.06
146 0.06
147 0.06
148 0.07
149 0.07
150 0.08
151 0.07
152 0.09
153 0.1
154 0.09
155 0.09
156 0.08
157 0.07
158 0.07
159 0.08
160 0.09
161 0.1