Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4N4S3

Protein Details
Accession A0A4S4N4S3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
160-183KQDTKERKAAEKRARKAERIRRAIBasic
NLS Segment(s)
PositionSequence
164-181KERKAAEKRARKAERIRR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR031658  Cyclin_C_2  
Pfam View protein in Pfam  
PF16899  Cyclin_C_2  
CDD cd20525  CYCLIN_CCNH_rpt2  
Amino Acid Sequences MCTVPYGEYGLTFRSVDSHIPHNHLASVLTAYQNLPDIRMDELRQAYDAALKLARTSRLTDAELLYTPSQIALACLSLASPALASAWVRSQFSSPPSSPSPPSQSSSPESAVFGILEPIKDMILTRGVLPDVEAVREVDRRLRLCKNPEKVVGSSAYQRKQDTKERKAAEKRARKAERIRRAIEDGDPFGTTLNEQDLDEDDEDDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.18
4 0.2
5 0.26
6 0.28
7 0.33
8 0.34
9 0.33
10 0.31
11 0.28
12 0.25
13 0.19
14 0.17
15 0.14
16 0.13
17 0.13
18 0.12
19 0.12
20 0.16
21 0.15
22 0.14
23 0.13
24 0.13
25 0.15
26 0.18
27 0.18
28 0.2
29 0.21
30 0.21
31 0.21
32 0.2
33 0.17
34 0.18
35 0.17
36 0.13
37 0.13
38 0.12
39 0.13
40 0.15
41 0.18
42 0.17
43 0.19
44 0.21
45 0.24
46 0.25
47 0.25
48 0.23
49 0.22
50 0.21
51 0.2
52 0.17
53 0.13
54 0.12
55 0.1
56 0.09
57 0.07
58 0.07
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.07
74 0.09
75 0.09
76 0.1
77 0.11
78 0.12
79 0.15
80 0.19
81 0.17
82 0.2
83 0.22
84 0.24
85 0.25
86 0.26
87 0.3
88 0.27
89 0.29
90 0.26
91 0.27
92 0.27
93 0.28
94 0.26
95 0.2
96 0.18
97 0.16
98 0.15
99 0.12
100 0.09
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.06
109 0.05
110 0.07
111 0.07
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.1
118 0.08
119 0.08
120 0.09
121 0.09
122 0.1
123 0.12
124 0.12
125 0.14
126 0.18
127 0.2
128 0.25
129 0.31
130 0.36
131 0.44
132 0.53
133 0.56
134 0.57
135 0.6
136 0.59
137 0.53
138 0.49
139 0.42
140 0.35
141 0.35
142 0.36
143 0.36
144 0.35
145 0.36
146 0.39
147 0.43
148 0.51
149 0.54
150 0.56
151 0.61
152 0.62
153 0.7
154 0.74
155 0.78
156 0.78
157 0.78
158 0.78
159 0.79
160 0.8
161 0.78
162 0.8
163 0.8
164 0.8
165 0.79
166 0.75
167 0.69
168 0.68
169 0.63
170 0.57
171 0.51
172 0.43
173 0.36
174 0.32
175 0.27
176 0.23
177 0.2
178 0.15
179 0.12
180 0.12
181 0.12
182 0.11
183 0.12
184 0.15
185 0.18
186 0.18
187 0.18
188 0.15