Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4N472

Protein Details
Accession A0A4S4N472    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
3-51RVPNVRKSESKPFQWPKKKTSNEHDATKPDKPAKTRKTPKDKPDRVYTDHydrophilic
NLS Segment(s)
PositionSequence
19-21KKK
28-43ATKPDKPAKTRKTPKD
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
Amino Acid Sequences MPRVPNVRKSESKPFQWPKKKTSNEHDATKPDKPAKTRKTPKDKPDRVYTDTVMTIKPQFAEMIANREKNYEYRKYELRETVERLWLYETAPTSCITYVMETTRPKRPGEVNDPSGVGNDDFDAGLKQSKFGYPVLGLYKLPTPISSTQLKATYVEDIRLEDMEKIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.81
4 0.81
5 0.79
6 0.82
7 0.84
8 0.82
9 0.81
10 0.81
11 0.77
12 0.77
13 0.74
14 0.7
15 0.66
16 0.62
17 0.59
18 0.55
19 0.53
20 0.53
21 0.58
22 0.6
23 0.66
24 0.72
25 0.76
26 0.8
27 0.84
28 0.88
29 0.89
30 0.88
31 0.83
32 0.83
33 0.79
34 0.73
35 0.68
36 0.59
37 0.5
38 0.44
39 0.39
40 0.28
41 0.23
42 0.19
43 0.15
44 0.14
45 0.12
46 0.1
47 0.09
48 0.13
49 0.12
50 0.18
51 0.21
52 0.22
53 0.22
54 0.23
55 0.24
56 0.24
57 0.28
58 0.29
59 0.28
60 0.31
61 0.36
62 0.38
63 0.41
64 0.41
65 0.4
66 0.36
67 0.37
68 0.35
69 0.34
70 0.31
71 0.27
72 0.24
73 0.2
74 0.17
75 0.14
76 0.13
77 0.09
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.09
87 0.14
88 0.17
89 0.2
90 0.27
91 0.3
92 0.29
93 0.32
94 0.36
95 0.38
96 0.44
97 0.48
98 0.44
99 0.43
100 0.43
101 0.39
102 0.34
103 0.28
104 0.19
105 0.11
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.06
112 0.11
113 0.11
114 0.11
115 0.12
116 0.14
117 0.15
118 0.15
119 0.17
120 0.14
121 0.18
122 0.2
123 0.21
124 0.19
125 0.19
126 0.22
127 0.21
128 0.21
129 0.17
130 0.19
131 0.19
132 0.24
133 0.26
134 0.26
135 0.28
136 0.31
137 0.31
138 0.28
139 0.27
140 0.3
141 0.27
142 0.27
143 0.24
144 0.22
145 0.23
146 0.23
147 0.22