Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MW40

Protein Details
Accession A0A4S4MW40    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MPPKRKRDAKKPGAEKPKTLLPQKRHYRQRAHANPFSDBasic
NLS Segment(s)
PositionSequence
3-26PKRKRDAKKPGAEKPKTLLPQKRH
Subcellular Location(s) cyto 12.5, cyto_nucl 10, mito 7, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR025763  Trm8_euk  
IPR003358  tRNA_(Gua-N-7)_MeTrfase_Trmb  
Gene Ontology GO:0005634  C:nucleus  
GO:0008176  F:tRNA (guanine-N7-)-methyltransferase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF02390  Methyltransf_4  
PROSITE View protein in PROSITE  
PS51625  SAM_MT_TRMB  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MPPKRKRDAKKPGAEKPKTLLPQKRHYRQRAHANPFSDHALVYPASPDVMDWELHYPAFAGTGKTPEFADVGCGFGGLLIALAPMFPDKLMLGMEIRVQVSQYVQDRITALRATSTAPEGSTDPGPYQNVSIVRANSMKFMTNYFPKHSLTALFFLFPDPHFKSRKHKARIISPTLLAEYAYVLRPGGIVYTITDVRDLHDWMRTHLEEFPLFEPVTEEALRAEGKGPIVDAVYTSTEEGKKVERNAGEKWLACFRRIEVPRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.79
3 0.73
4 0.71
5 0.68
6 0.68
7 0.66
8 0.63
9 0.69
10 0.76
11 0.81
12 0.82
13 0.84
14 0.84
15 0.85
16 0.88
17 0.88
18 0.86
19 0.82
20 0.76
21 0.69
22 0.61
23 0.56
24 0.45
25 0.34
26 0.25
27 0.21
28 0.17
29 0.15
30 0.13
31 0.09
32 0.09
33 0.09
34 0.08
35 0.08
36 0.1
37 0.1
38 0.1
39 0.12
40 0.13
41 0.13
42 0.13
43 0.1
44 0.09
45 0.11
46 0.1
47 0.1
48 0.1
49 0.14
50 0.14
51 0.15
52 0.15
53 0.14
54 0.13
55 0.11
56 0.15
57 0.11
58 0.12
59 0.11
60 0.1
61 0.09
62 0.09
63 0.09
64 0.04
65 0.04
66 0.02
67 0.02
68 0.02
69 0.02
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.06
80 0.06
81 0.08
82 0.08
83 0.09
84 0.08
85 0.08
86 0.08
87 0.08
88 0.11
89 0.12
90 0.13
91 0.13
92 0.14
93 0.14
94 0.14
95 0.16
96 0.13
97 0.1
98 0.09
99 0.09
100 0.09
101 0.09
102 0.1
103 0.08
104 0.08
105 0.09
106 0.09
107 0.1
108 0.1
109 0.1
110 0.09
111 0.1
112 0.11
113 0.1
114 0.1
115 0.1
116 0.1
117 0.12
118 0.14
119 0.12
120 0.14
121 0.15
122 0.15
123 0.14
124 0.14
125 0.13
126 0.12
127 0.13
128 0.15
129 0.19
130 0.21
131 0.23
132 0.24
133 0.24
134 0.24
135 0.23
136 0.22
137 0.18
138 0.18
139 0.15
140 0.13
141 0.12
142 0.12
143 0.13
144 0.11
145 0.15
146 0.17
147 0.21
148 0.24
149 0.27
150 0.35
151 0.45
152 0.55
153 0.56
154 0.57
155 0.59
156 0.66
157 0.72
158 0.7
159 0.62
160 0.53
161 0.47
162 0.42
163 0.36
164 0.26
165 0.17
166 0.11
167 0.09
168 0.09
169 0.08
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.05
176 0.05
177 0.05
178 0.09
179 0.1
180 0.1
181 0.11
182 0.11
183 0.12
184 0.14
185 0.14
186 0.12
187 0.18
188 0.18
189 0.19
190 0.25
191 0.24
192 0.24
193 0.25
194 0.27
195 0.22
196 0.24
197 0.23
198 0.2
199 0.2
200 0.18
201 0.17
202 0.15
203 0.19
204 0.16
205 0.15
206 0.12
207 0.14
208 0.14
209 0.13
210 0.13
211 0.11
212 0.12
213 0.12
214 0.12
215 0.11
216 0.11
217 0.1
218 0.1
219 0.1
220 0.11
221 0.11
222 0.12
223 0.15
224 0.15
225 0.16
226 0.18
227 0.2
228 0.25
229 0.27
230 0.34
231 0.35
232 0.38
233 0.41
234 0.47
235 0.47
236 0.43
237 0.44
238 0.47
239 0.43
240 0.41
241 0.4
242 0.35
243 0.4