Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MZJ2

Protein Details
Accession A0A4S4MZJ2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
138-157VKKVAKSKAHKGKGKRELAEBasic
NLS Segment(s)
PositionSequence
137-153RVKKVAKSKAHKGKGKR
Subcellular Location(s) extr 14, mito 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MKTSSALILIAACFSSVSAHHSGSRHHVVSAPPPTGPVGSPPFGIGPLAHSARSEHENRFGITFDHATLAHPARSEVFARDVVDYLYARSVNLTPAQLGPGAGIGAAPNAASNEINNMMGASMKGPATASANVVGGRVKKVAKSKAHKGKGKRELAELVARALADDHLFARNVLDRASKLADNPTREPPFCVLTRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.07
4 0.11
5 0.13
6 0.15
7 0.19
8 0.2
9 0.23
10 0.29
11 0.35
12 0.32
13 0.29
14 0.31
15 0.3
16 0.36
17 0.4
18 0.33
19 0.27
20 0.27
21 0.27
22 0.25
23 0.22
24 0.2
25 0.19
26 0.19
27 0.19
28 0.19
29 0.18
30 0.18
31 0.18
32 0.12
33 0.1
34 0.14
35 0.14
36 0.14
37 0.14
38 0.15
39 0.17
40 0.22
41 0.23
42 0.2
43 0.26
44 0.27
45 0.28
46 0.28
47 0.25
48 0.21
49 0.2
50 0.19
51 0.13
52 0.12
53 0.11
54 0.11
55 0.15
56 0.15
57 0.14
58 0.13
59 0.13
60 0.12
61 0.14
62 0.14
63 0.12
64 0.13
65 0.13
66 0.14
67 0.14
68 0.13
69 0.11
70 0.12
71 0.1
72 0.09
73 0.09
74 0.08
75 0.07
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.08
82 0.08
83 0.09
84 0.08
85 0.08
86 0.06
87 0.05
88 0.05
89 0.04
90 0.03
91 0.03
92 0.03
93 0.03
94 0.02
95 0.02
96 0.03
97 0.04
98 0.04
99 0.04
100 0.06
101 0.06
102 0.07
103 0.06
104 0.06
105 0.05
106 0.06
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.09
115 0.09
116 0.1
117 0.09
118 0.1
119 0.1
120 0.11
121 0.12
122 0.1
123 0.11
124 0.13
125 0.13
126 0.16
127 0.24
128 0.32
129 0.39
130 0.46
131 0.56
132 0.64
133 0.72
134 0.75
135 0.77
136 0.79
137 0.8
138 0.8
139 0.72
140 0.66
141 0.59
142 0.56
143 0.53
144 0.43
145 0.34
146 0.26
147 0.23
148 0.19
149 0.16
150 0.13
151 0.08
152 0.08
153 0.08
154 0.09
155 0.1
156 0.1
157 0.11
158 0.15
159 0.16
160 0.17
161 0.19
162 0.17
163 0.21
164 0.25
165 0.24
166 0.21
167 0.3
168 0.34
169 0.37
170 0.41
171 0.47
172 0.5
173 0.5
174 0.52
175 0.46
176 0.45
177 0.43