Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4MNE3

Protein Details
Accession A0A4S4MNE3    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
193-217VPRAASRPQRATRRRRPVWSTKTDDHydrophilic
228-248DTIRHKKESGRAAKRPKVTRSBasic
NLS Segment(s)
PositionSequence
134-149KVAPKVPNKPRARPRP
187-209RPGKTPLVPRAASRPQRATRRRR
235-247HKKESGRAAKRPK
Subcellular Location(s) nucl 9, cyto 8, extr 5, mito 3
Family & Domain DBs
Amino Acid Sequences MPSHLSAPIFAVALTQVVQWLDFKTFGRASWYDRAILLLREASDAAPSLDDLKLAEVRMGVRAALKDKVLTTHPPVAFFEELAMPVTPAGAPIFASKLDELDLVSGRDHAAQAAKIEERWAEADALWRDKATPKVAPKVPNKPRARPRPTPVAATPVATPPPKVLVKRKEAPPSSDDDXDVSPPPARPGKTPLVPRAASRPQRATRRRRPVWSTKTDDEDDFSQXAADXPDTIRHKKESGRAAKRPKVTRSDKEAYPDEDPEAVVSEWFVYRELQVRRLCSLRSCPLTYXCWRRNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.08
4 0.08
5 0.08
6 0.09
7 0.11
8 0.12
9 0.14
10 0.14
11 0.19
12 0.2
13 0.2
14 0.26
15 0.26
16 0.3
17 0.36
18 0.37
19 0.32
20 0.31
21 0.33
22 0.28
23 0.27
24 0.23
25 0.17
26 0.16
27 0.16
28 0.16
29 0.13
30 0.12
31 0.12
32 0.1
33 0.09
34 0.08
35 0.09
36 0.09
37 0.09
38 0.08
39 0.1
40 0.11
41 0.11
42 0.12
43 0.11
44 0.11
45 0.13
46 0.13
47 0.11
48 0.12
49 0.13
50 0.16
51 0.16
52 0.16
53 0.16
54 0.16
55 0.18
56 0.19
57 0.21
58 0.24
59 0.31
60 0.31
61 0.31
62 0.31
63 0.33
64 0.3
65 0.26
66 0.22
67 0.14
68 0.14
69 0.13
70 0.12
71 0.08
72 0.07
73 0.08
74 0.06
75 0.06
76 0.06
77 0.04
78 0.05
79 0.06
80 0.07
81 0.06
82 0.08
83 0.07
84 0.08
85 0.08
86 0.08
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08
96 0.07
97 0.08
98 0.08
99 0.08
100 0.1
101 0.1
102 0.09
103 0.1
104 0.1
105 0.09
106 0.1
107 0.1
108 0.08
109 0.08
110 0.14
111 0.15
112 0.17
113 0.16
114 0.15
115 0.14
116 0.17
117 0.2
118 0.17
119 0.21
120 0.22
121 0.3
122 0.34
123 0.41
124 0.45
125 0.52
126 0.58
127 0.63
128 0.64
129 0.65
130 0.71
131 0.74
132 0.76
133 0.73
134 0.69
135 0.7
136 0.67
137 0.62
138 0.53
139 0.48
140 0.4
141 0.34
142 0.29
143 0.2
144 0.21
145 0.17
146 0.16
147 0.11
148 0.16
149 0.17
150 0.2
151 0.27
152 0.32
153 0.39
154 0.46
155 0.52
156 0.56
157 0.56
158 0.56
159 0.49
160 0.48
161 0.44
162 0.38
163 0.32
164 0.25
165 0.25
166 0.22
167 0.23
168 0.17
169 0.14
170 0.16
171 0.2
172 0.19
173 0.19
174 0.25
175 0.29
176 0.34
177 0.39
178 0.41
179 0.44
180 0.44
181 0.43
182 0.45
183 0.47
184 0.48
185 0.48
186 0.52
187 0.52
188 0.62
189 0.71
190 0.73
191 0.75
192 0.79
193 0.81
194 0.81
195 0.82
196 0.82
197 0.82
198 0.81
199 0.78
200 0.71
201 0.7
202 0.63
203 0.55
204 0.48
205 0.4
206 0.33
207 0.25
208 0.21
209 0.16
210 0.14
211 0.14
212 0.11
213 0.1
214 0.1
215 0.18
216 0.23
217 0.25
218 0.27
219 0.29
220 0.34
221 0.41
222 0.49
223 0.52
224 0.57
225 0.64
226 0.72
227 0.77
228 0.8
229 0.81
230 0.78
231 0.77
232 0.77
233 0.76
234 0.75
235 0.74
236 0.68
237 0.66
238 0.64
239 0.58
240 0.52
241 0.45
242 0.38
243 0.32
244 0.29
245 0.23
246 0.2
247 0.16
248 0.12
249 0.11
250 0.1
251 0.1
252 0.11
253 0.11
254 0.09
255 0.11
256 0.19
257 0.22
258 0.29
259 0.32
260 0.35
261 0.39
262 0.41
263 0.42
264 0.41
265 0.45
266 0.47
267 0.49
268 0.49
269 0.47
270 0.5
271 0.59
272 0.62