Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4MZJ3

Protein Details
Accession A0A4S4MZJ3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-32RLYSKGRILGHKRGKRNTRPNTTLVHydrophilic
NLS Segment(s)
PositionSequence
19-22KRGK
Subcellular Location(s) mito 16, cyto 7, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MLTRCATRLYSKGRILGHKRGKRNTRPNTTLVQIEGVATKEEAQFYLGKRVAFVYRAKKEIHGTKIRVIWGRVTRPHGGNGVVKSKFTSNIPPHAFGASVRVMLYPSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.62
4 0.65
5 0.65
6 0.7
7 0.75
8 0.8
9 0.81
10 0.85
11 0.85
12 0.84
13 0.81
14 0.76
15 0.7
16 0.62
17 0.53
18 0.43
19 0.34
20 0.23
21 0.19
22 0.16
23 0.12
24 0.1
25 0.09
26 0.09
27 0.08
28 0.08
29 0.08
30 0.09
31 0.1
32 0.1
33 0.18
34 0.18
35 0.18
36 0.18
37 0.19
38 0.18
39 0.19
40 0.23
41 0.24
42 0.25
43 0.28
44 0.28
45 0.29
46 0.33
47 0.37
48 0.4
49 0.39
50 0.38
51 0.4
52 0.42
53 0.43
54 0.41
55 0.35
56 0.34
57 0.32
58 0.36
59 0.36
60 0.38
61 0.39
62 0.38
63 0.39
64 0.34
65 0.31
66 0.31
67 0.3
68 0.32
69 0.29
70 0.27
71 0.27
72 0.27
73 0.26
74 0.24
75 0.31
76 0.28
77 0.37
78 0.41
79 0.42
80 0.41
81 0.4
82 0.38
83 0.28
84 0.28
85 0.2
86 0.17
87 0.14
88 0.14
89 0.13