Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3M5X7

Protein Details
Accession A0A5C3M5X7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
203-227DPVLVTKKGKAKKRKLHDRLDVTPAHydrophilic
NLS Segment(s)
PositionSequence
209-217KKGKAKKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 15, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MSTEAERTGLHSLPVELLYEIQLYALSKDLPYTSQHIRDVFISASPRYRAQYLLERAKTSNSISRSDIFSRVLRYGLCSKDVIEALIPMLLDDPLSISSQRYELPRRLFRRLAPKTSSDQWKDHDEPLPFLQYLFTIPDIPTPYIDSHDGYALTKAVHARFVPLIQYLLGQGASPARKHALAVTVAIRKKDLELVKLLVERRDPVLVTKKGKAKKRKLHDRLDVTPAMLKTAVKCDARDIVDYLIQEKGVIPDMQTLQMLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.12
4 0.12
5 0.12
6 0.11
7 0.1
8 0.08
9 0.09
10 0.08
11 0.09
12 0.09
13 0.09
14 0.09
15 0.1
16 0.11
17 0.12
18 0.14
19 0.19
20 0.23
21 0.28
22 0.32
23 0.31
24 0.32
25 0.31
26 0.31
27 0.26
28 0.23
29 0.21
30 0.19
31 0.23
32 0.24
33 0.25
34 0.25
35 0.26
36 0.24
37 0.25
38 0.33
39 0.37
40 0.45
41 0.45
42 0.45
43 0.45
44 0.45
45 0.43
46 0.37
47 0.34
48 0.27
49 0.28
50 0.28
51 0.29
52 0.32
53 0.32
54 0.31
55 0.28
56 0.27
57 0.27
58 0.26
59 0.24
60 0.2
61 0.22
62 0.25
63 0.23
64 0.23
65 0.21
66 0.2
67 0.22
68 0.22
69 0.19
70 0.13
71 0.11
72 0.09
73 0.1
74 0.09
75 0.05
76 0.05
77 0.05
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.11
88 0.14
89 0.18
90 0.23
91 0.3
92 0.39
93 0.43
94 0.48
95 0.48
96 0.49
97 0.55
98 0.56
99 0.54
100 0.49
101 0.48
102 0.46
103 0.5
104 0.53
105 0.46
106 0.42
107 0.38
108 0.42
109 0.41
110 0.39
111 0.38
112 0.31
113 0.29
114 0.28
115 0.27
116 0.2
117 0.17
118 0.15
119 0.1
120 0.1
121 0.09
122 0.08
123 0.07
124 0.07
125 0.1
126 0.12
127 0.12
128 0.11
129 0.12
130 0.12
131 0.13
132 0.14
133 0.12
134 0.1
135 0.11
136 0.11
137 0.1
138 0.1
139 0.08
140 0.07
141 0.08
142 0.1
143 0.09
144 0.11
145 0.11
146 0.12
147 0.13
148 0.13
149 0.13
150 0.11
151 0.12
152 0.09
153 0.09
154 0.08
155 0.08
156 0.07
157 0.06
158 0.05
159 0.09
160 0.1
161 0.1
162 0.11
163 0.12
164 0.12
165 0.13
166 0.14
167 0.14
168 0.13
169 0.15
170 0.18
171 0.23
172 0.25
173 0.25
174 0.24
175 0.2
176 0.21
177 0.26
178 0.23
179 0.2
180 0.21
181 0.23
182 0.25
183 0.28
184 0.29
185 0.24
186 0.23
187 0.22
188 0.21
189 0.21
190 0.18
191 0.21
192 0.29
193 0.33
194 0.36
195 0.41
196 0.47
197 0.53
198 0.62
199 0.67
200 0.69
201 0.72
202 0.79
203 0.84
204 0.86
205 0.89
206 0.9
207 0.88
208 0.82
209 0.79
210 0.68
211 0.58
212 0.53
213 0.43
214 0.34
215 0.27
216 0.22
217 0.17
218 0.22
219 0.27
220 0.25
221 0.25
222 0.27
223 0.32
224 0.34
225 0.34
226 0.31
227 0.27
228 0.27
229 0.27
230 0.25
231 0.2
232 0.17
233 0.15
234 0.14
235 0.13
236 0.14
237 0.14
238 0.14
239 0.18
240 0.2
241 0.22
242 0.21