Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LE67

Protein Details
Accession A0A5C3LE67    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
152-186TDAKKKRKATSGKMSTGKKRKRVVKPKPTGAQKRMBasic
NLS Segment(s)
PositionSequence
154-186AKKKRKATSGKMSTGKKRKRVVKPKPTGAQKRM
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARAKETTAAEKVPLLDTRLDSDEEELEAEKRSVTLDGKASESDSDESHKEGPEDAGEDVPTPDPRFNPPTPSRWSRLALLLFVAFLFYVGFGMRQNLWKAKKPEIVYASRYSKEFKYRPAASPIITETMKDGRIRLRGATPPPAAPTPQATDAKKKRKATSGKMSTGKKRKRVVKPKPTGAQKRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.21
4 0.21
5 0.23
6 0.24
7 0.24
8 0.21
9 0.21
10 0.19
11 0.17
12 0.16
13 0.13
14 0.12
15 0.12
16 0.12
17 0.1
18 0.09
19 0.1
20 0.11
21 0.12
22 0.15
23 0.17
24 0.19
25 0.2
26 0.21
27 0.21
28 0.19
29 0.2
30 0.17
31 0.14
32 0.15
33 0.15
34 0.16
35 0.17
36 0.17
37 0.15
38 0.15
39 0.15
40 0.12
41 0.13
42 0.12
43 0.11
44 0.1
45 0.1
46 0.1
47 0.11
48 0.12
49 0.12
50 0.12
51 0.13
52 0.17
53 0.23
54 0.24
55 0.31
56 0.32
57 0.37
58 0.42
59 0.46
60 0.45
61 0.43
62 0.44
63 0.37
64 0.38
65 0.33
66 0.26
67 0.22
68 0.18
69 0.14
70 0.11
71 0.1
72 0.05
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.05
81 0.05
82 0.08
83 0.1
84 0.16
85 0.19
86 0.25
87 0.29
88 0.33
89 0.38
90 0.38
91 0.42
92 0.41
93 0.42
94 0.39
95 0.42
96 0.4
97 0.36
98 0.35
99 0.32
100 0.3
101 0.35
102 0.33
103 0.33
104 0.38
105 0.41
106 0.43
107 0.47
108 0.45
109 0.37
110 0.37
111 0.33
112 0.28
113 0.24
114 0.21
115 0.17
116 0.17
117 0.19
118 0.17
119 0.18
120 0.18
121 0.23
122 0.24
123 0.24
124 0.26
125 0.29
126 0.33
127 0.39
128 0.36
129 0.33
130 0.35
131 0.35
132 0.31
133 0.27
134 0.27
135 0.24
136 0.28
137 0.33
138 0.32
139 0.41
140 0.5
141 0.59
142 0.64
143 0.67
144 0.67
145 0.7
146 0.78
147 0.77
148 0.78
149 0.77
150 0.78
151 0.79
152 0.8
153 0.81
154 0.82
155 0.81
156 0.79
157 0.79
158 0.8
159 0.83
160 0.87
161 0.88
162 0.88
163 0.9
164 0.91
165 0.92
166 0.92