Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LU60

Protein Details
Accession A0A5C3LU60    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-87WDGVISSRRTRRRRSWRKEVVEKKKWKYFHydrophilic
NLS Segment(s)
PositionSequence
66-83RRTRRRRSWRKEVVEKKK
Subcellular Location(s) cyto 17, cyto_nucl 12.5, nucl 6, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000873  AMP-dep_Synth/Lig_com  
IPR042099  ANL_N_sf  
Pfam View protein in Pfam  
PF00501  AMP-binding  
Amino Acid Sequences MHYGEGSIEVTPPTSATAGPIGRCTLSTDGLITQPFAGTDTVDDIIAHAARTTVRALPWDGVISSRRTRRRRSWRKEVVEKKKWKYFELSAYKYLSFVEMKAAVEEIARALVDLGVGKGGVFNVYARTSPNWQFMAYACSSISTTIATAYDTLGKSGLTHSLHEPSCVGLFTNAELFPTLLNVLPHAPSVKYIVFDGAPSQKILDSLHAVWEDIKVFSID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.16
5 0.17
6 0.18
7 0.2
8 0.2
9 0.19
10 0.2
11 0.22
12 0.19
13 0.18
14 0.18
15 0.17
16 0.17
17 0.18
18 0.18
19 0.15
20 0.13
21 0.11
22 0.1
23 0.1
24 0.09
25 0.07
26 0.07
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.1
33 0.1
34 0.09
35 0.07
36 0.07
37 0.07
38 0.09
39 0.1
40 0.1
41 0.1
42 0.13
43 0.14
44 0.14
45 0.15
46 0.15
47 0.13
48 0.13
49 0.15
50 0.17
51 0.22
52 0.29
53 0.37
54 0.43
55 0.51
56 0.6
57 0.69
58 0.76
59 0.8
60 0.84
61 0.85
62 0.88
63 0.9
64 0.91
65 0.9
66 0.89
67 0.88
68 0.84
69 0.79
70 0.72
71 0.63
72 0.58
73 0.51
74 0.51
75 0.51
76 0.48
77 0.45
78 0.45
79 0.42
80 0.37
81 0.32
82 0.24
83 0.15
84 0.12
85 0.1
86 0.1
87 0.1
88 0.1
89 0.1
90 0.08
91 0.07
92 0.07
93 0.05
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.05
111 0.06
112 0.07
113 0.08
114 0.1
115 0.14
116 0.17
117 0.21
118 0.2
119 0.19
120 0.2
121 0.19
122 0.22
123 0.18
124 0.16
125 0.11
126 0.11
127 0.11
128 0.11
129 0.1
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.1
138 0.1
139 0.1
140 0.1
141 0.09
142 0.09
143 0.1
144 0.15
145 0.12
146 0.14
147 0.16
148 0.22
149 0.22
150 0.22
151 0.22
152 0.17
153 0.17
154 0.15
155 0.14
156 0.09
157 0.09
158 0.09
159 0.12
160 0.1
161 0.1
162 0.1
163 0.1
164 0.09
165 0.09
166 0.09
167 0.08
168 0.08
169 0.09
170 0.1
171 0.1
172 0.12
173 0.12
174 0.12
175 0.12
176 0.16
177 0.16
178 0.15
179 0.15
180 0.17
181 0.15
182 0.15
183 0.19
184 0.2
185 0.2
186 0.19
187 0.2
188 0.18
189 0.19
190 0.2
191 0.19
192 0.19
193 0.18
194 0.23
195 0.22
196 0.22
197 0.21
198 0.22
199 0.2
200 0.15