Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5FE04

Protein Details
Accession C5FE04    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
171-193LMGFLYLYRRRRRRREIESYLLSHydrophilic
NLS Segment(s)
PositionSequence
181-184RRRR
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, cyto 3.5, mito 3, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSIEDCRTRWRLRRDEEEEPTTYRNDSSVRLRFGGWEQEYIDRCLVRRRYNQSLWLVSVDESYRELLAPVNVSNHYEETRVTIVVPKPVLSEMSTFRFDIKSCSERDCYDDSRAISSDEFYVQALSTAPRTLGSSSTEPLEPEEPPSGLSPGGRVGIGIGLGLAAIALGLMGFLYLYRRRRRRREIESYLLSAAAEETTVTAKATSEEATVAEMPASNSPEAHKRPIFEMEGQEQHKELQGSLPASEMPGSQPAPAELAGSPHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.79
4 0.79
5 0.75
6 0.68
7 0.61
8 0.55
9 0.46
10 0.39
11 0.3
12 0.24
13 0.21
14 0.23
15 0.28
16 0.33
17 0.35
18 0.36
19 0.36
20 0.36
21 0.37
22 0.42
23 0.34
24 0.3
25 0.28
26 0.33
27 0.35
28 0.35
29 0.34
30 0.25
31 0.25
32 0.31
33 0.36
34 0.39
35 0.45
36 0.51
37 0.57
38 0.61
39 0.67
40 0.65
41 0.61
42 0.54
43 0.46
44 0.39
45 0.3
46 0.28
47 0.2
48 0.15
49 0.12
50 0.12
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.11
59 0.12
60 0.13
61 0.14
62 0.15
63 0.14
64 0.14
65 0.13
66 0.14
67 0.15
68 0.14
69 0.12
70 0.16
71 0.17
72 0.2
73 0.2
74 0.17
75 0.17
76 0.17
77 0.18
78 0.13
79 0.14
80 0.14
81 0.17
82 0.18
83 0.18
84 0.18
85 0.18
86 0.17
87 0.18
88 0.21
89 0.2
90 0.21
91 0.24
92 0.25
93 0.25
94 0.29
95 0.3
96 0.27
97 0.27
98 0.28
99 0.25
100 0.24
101 0.24
102 0.21
103 0.17
104 0.14
105 0.12
106 0.09
107 0.09
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.08
121 0.1
122 0.11
123 0.11
124 0.13
125 0.13
126 0.12
127 0.13
128 0.13
129 0.1
130 0.11
131 0.12
132 0.1
133 0.11
134 0.12
135 0.11
136 0.1
137 0.09
138 0.08
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.03
148 0.02
149 0.02
150 0.02
151 0.02
152 0.01
153 0.01
154 0.01
155 0.01
156 0.01
157 0.01
158 0.01
159 0.01
160 0.01
161 0.02
162 0.05
163 0.1
164 0.17
165 0.27
166 0.37
167 0.47
168 0.57
169 0.68
170 0.75
171 0.81
172 0.85
173 0.84
174 0.83
175 0.78
176 0.71
177 0.6
178 0.5
179 0.39
180 0.29
181 0.2
182 0.11
183 0.07
184 0.04
185 0.04
186 0.05
187 0.06
188 0.06
189 0.06
190 0.06
191 0.07
192 0.09
193 0.09
194 0.08
195 0.09
196 0.09
197 0.11
198 0.11
199 0.1
200 0.09
201 0.09
202 0.09
203 0.11
204 0.13
205 0.11
206 0.12
207 0.14
208 0.22
209 0.25
210 0.32
211 0.32
212 0.32
213 0.35
214 0.4
215 0.41
216 0.37
217 0.39
218 0.37
219 0.42
220 0.42
221 0.4
222 0.35
223 0.32
224 0.32
225 0.27
226 0.22
227 0.18
228 0.21
229 0.21
230 0.21
231 0.21
232 0.17
233 0.18
234 0.18
235 0.14
236 0.11
237 0.15
238 0.16
239 0.15
240 0.16
241 0.16
242 0.17
243 0.17
244 0.16
245 0.12