Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LTD6

Protein Details
Accession A0A5C3LTD6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-84RMTGLGRVRRRKQNEKLLARLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 4, E.R. 3, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGRIVQRKLRCVRFQRVPFSSDVTARLLSVTVLVYILAYLIGVHQAPISLGCSPSLVHRNSSRMTGLGRVRRRKQNEKLLARLFSTNVPLSLLAQTIVRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.72
4 0.66
5 0.58
6 0.55
7 0.47
8 0.38
9 0.33
10 0.26
11 0.23
12 0.2
13 0.18
14 0.13
15 0.11
16 0.1
17 0.08
18 0.05
19 0.05
20 0.05
21 0.04
22 0.04
23 0.04
24 0.03
25 0.03
26 0.02
27 0.02
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.09
42 0.15
43 0.14
44 0.17
45 0.19
46 0.23
47 0.23
48 0.25
49 0.23
50 0.18
51 0.18
52 0.22
53 0.26
54 0.31
55 0.39
56 0.46
57 0.53
58 0.62
59 0.7
60 0.74
61 0.77
62 0.8
63 0.82
64 0.8
65 0.81
66 0.77
67 0.71
68 0.63
69 0.55
70 0.45
71 0.36
72 0.34
73 0.26
74 0.2
75 0.19
76 0.17
77 0.17
78 0.17
79 0.15
80 0.11