Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LGT5

Protein Details
Accession A0A5C3LGT5    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-55IQKQYFWRRRDNTRRTGRRTSSASRRKICRRCWRLQSINKQLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6, extr 3
Family & Domain DBs
Amino Acid Sequences MLLVLQRYLGCIGIQKQYFWRRRDNTRRTGRRTSSASRRKICRRCWRLQSINKQLVNRSAHLKETIQDANNASCEDSRWDAVWAMVPFTGWAPSTRINTGQRTFALAIEIIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.31
4 0.4
5 0.48
6 0.47
7 0.55
8 0.54
9 0.65
10 0.74
11 0.75
12 0.76
13 0.79
14 0.85
15 0.83
16 0.86
17 0.8
18 0.76
19 0.73
20 0.71
21 0.71
22 0.7
23 0.71
24 0.68
25 0.72
26 0.75
27 0.77
28 0.79
29 0.79
30 0.78
31 0.78
32 0.8
33 0.81
34 0.81
35 0.81
36 0.81
37 0.8
38 0.79
39 0.73
40 0.65
41 0.56
42 0.53
43 0.47
44 0.38
45 0.33
46 0.26
47 0.24
48 0.25
49 0.24
50 0.18
51 0.2
52 0.22
53 0.18
54 0.18
55 0.18
56 0.18
57 0.18
58 0.17
59 0.13
60 0.1
61 0.11
62 0.12
63 0.13
64 0.13
65 0.12
66 0.13
67 0.13
68 0.13
69 0.18
70 0.15
71 0.14
72 0.13
73 0.12
74 0.11
75 0.11
76 0.12
77 0.08
78 0.09
79 0.12
80 0.16
81 0.2
82 0.22
83 0.28
84 0.32
85 0.38
86 0.4
87 0.4
88 0.36
89 0.38
90 0.37
91 0.31
92 0.28