Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MHS0

Protein Details
Accession A0A5C3MHS0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
429-451GLFTFNKRSTKARKTNSKAGSDIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029033  His_PPase_superfam  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSNSDKILGVVVLARHGDRQGFYQDPITYNPSNTAITPLGNVQEFQLGQKLRSIYFNSSSPSFISGINTTVADETQLHVRADGGGERGVIFNSAVSVLQGLFPATQAYNTTLANGTTVIGPLGGYQYVPIESVEPDNDISLEGWTSCGEFTNSNIAFYSSPAFKQKEADHADFLKSLTPYVGGRNVSLQNMWNIYDFMNVESIHDAKFQQALPLTFLEQARDLANWHEYGIFSSPQLDGIGNIAGQAILPSILEGFASITNSSDPIKFVYEAIAYKPFLSLFNMTGVAQQNPELASIVNYAAVLALEVRQPASGGPVIRFNFKNGTDANGTDSDFKTYNFLGESGDVPLSTFVSTLSTHALQGLPAWCTVCQNQQDRGCGDLAAAKLLGMQAAESQSHRSVSPVAAGFIGAAVTLVFLAIVLFFLSLLGLFTFNKRSTKARKTNSKAGSDINSLEYKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.19
5 0.17
6 0.2
7 0.24
8 0.26
9 0.27
10 0.3
11 0.31
12 0.31
13 0.33
14 0.36
15 0.32
16 0.3
17 0.31
18 0.29
19 0.27
20 0.25
21 0.26
22 0.21
23 0.2
24 0.2
25 0.19
26 0.19
27 0.19
28 0.18
29 0.15
30 0.18
31 0.17
32 0.17
33 0.22
34 0.2
35 0.2
36 0.25
37 0.26
38 0.23
39 0.28
40 0.31
41 0.29
42 0.32
43 0.35
44 0.34
45 0.33
46 0.33
47 0.29
48 0.27
49 0.23
50 0.19
51 0.2
52 0.17
53 0.17
54 0.17
55 0.16
56 0.14
57 0.14
58 0.13
59 0.11
60 0.1
61 0.1
62 0.14
63 0.17
64 0.16
65 0.16
66 0.16
67 0.16
68 0.16
69 0.17
70 0.13
71 0.11
72 0.11
73 0.11
74 0.12
75 0.11
76 0.1
77 0.08
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07
88 0.06
89 0.06
90 0.08
91 0.08
92 0.08
93 0.09
94 0.11
95 0.13
96 0.12
97 0.14
98 0.13
99 0.13
100 0.13
101 0.11
102 0.1
103 0.08
104 0.08
105 0.06
106 0.06
107 0.05
108 0.05
109 0.06
110 0.06
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.08
119 0.09
120 0.1
121 0.1
122 0.1
123 0.09
124 0.09
125 0.09
126 0.08
127 0.07
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.07
136 0.07
137 0.09
138 0.17
139 0.17
140 0.17
141 0.17
142 0.18
143 0.17
144 0.17
145 0.19
146 0.11
147 0.12
148 0.18
149 0.19
150 0.19
151 0.23
152 0.24
153 0.3
154 0.36
155 0.36
156 0.34
157 0.34
158 0.34
159 0.3
160 0.29
161 0.23
162 0.16
163 0.14
164 0.11
165 0.11
166 0.1
167 0.11
168 0.15
169 0.13
170 0.13
171 0.17
172 0.18
173 0.17
174 0.17
175 0.16
176 0.14
177 0.14
178 0.15
179 0.11
180 0.11
181 0.1
182 0.11
183 0.1
184 0.09
185 0.1
186 0.09
187 0.09
188 0.1
189 0.1
190 0.09
191 0.1
192 0.09
193 0.08
194 0.1
195 0.1
196 0.11
197 0.12
198 0.12
199 0.13
200 0.13
201 0.13
202 0.14
203 0.14
204 0.13
205 0.11
206 0.12
207 0.1
208 0.1
209 0.09
210 0.08
211 0.09
212 0.09
213 0.08
214 0.08
215 0.07
216 0.08
217 0.1
218 0.09
219 0.07
220 0.08
221 0.08
222 0.08
223 0.08
224 0.07
225 0.06
226 0.06
227 0.06
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.04
234 0.03
235 0.03
236 0.03
237 0.02
238 0.03
239 0.03
240 0.03
241 0.03
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.06
248 0.07
249 0.08
250 0.07
251 0.08
252 0.08
253 0.1
254 0.1
255 0.1
256 0.1
257 0.11
258 0.11
259 0.13
260 0.14
261 0.13
262 0.13
263 0.13
264 0.12
265 0.11
266 0.13
267 0.12
268 0.1
269 0.11
270 0.12
271 0.12
272 0.15
273 0.15
274 0.14
275 0.13
276 0.12
277 0.12
278 0.11
279 0.11
280 0.08
281 0.07
282 0.07
283 0.08
284 0.07
285 0.07
286 0.06
287 0.06
288 0.05
289 0.05
290 0.04
291 0.03
292 0.04
293 0.05
294 0.05
295 0.06
296 0.06
297 0.06
298 0.06
299 0.08
300 0.1
301 0.1
302 0.11
303 0.17
304 0.19
305 0.23
306 0.24
307 0.24
308 0.27
309 0.26
310 0.29
311 0.23
312 0.26
313 0.23
314 0.23
315 0.24
316 0.21
317 0.21
318 0.2
319 0.2
320 0.19
321 0.18
322 0.18
323 0.17
324 0.15
325 0.16
326 0.13
327 0.13
328 0.11
329 0.12
330 0.12
331 0.11
332 0.11
333 0.1
334 0.09
335 0.1
336 0.09
337 0.08
338 0.07
339 0.05
340 0.07
341 0.08
342 0.09
343 0.12
344 0.12
345 0.12
346 0.13
347 0.13
348 0.11
349 0.14
350 0.15
351 0.12
352 0.12
353 0.13
354 0.13
355 0.15
356 0.17
357 0.21
358 0.27
359 0.31
360 0.38
361 0.42
362 0.46
363 0.45
364 0.45
365 0.38
366 0.31
367 0.26
368 0.22
369 0.17
370 0.14
371 0.13
372 0.1
373 0.1
374 0.1
375 0.1
376 0.06
377 0.06
378 0.07
379 0.09
380 0.1
381 0.11
382 0.14
383 0.16
384 0.17
385 0.17
386 0.17
387 0.18
388 0.17
389 0.22
390 0.19
391 0.18
392 0.17
393 0.17
394 0.15
395 0.13
396 0.12
397 0.06
398 0.04
399 0.03
400 0.03
401 0.03
402 0.03
403 0.03
404 0.03
405 0.03
406 0.03
407 0.03
408 0.03
409 0.03
410 0.03
411 0.04
412 0.04
413 0.04
414 0.05
415 0.05
416 0.06
417 0.07
418 0.1
419 0.17
420 0.2
421 0.24
422 0.27
423 0.35
424 0.44
425 0.55
426 0.62
427 0.67
428 0.75
429 0.8
430 0.87
431 0.87
432 0.82
433 0.75
434 0.7
435 0.65
436 0.58
437 0.51
438 0.45