Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3M2P4

Protein Details
Accession A0A5C3M2P4    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-102SPPCRYGSTIHPHTRRRRRFLHLYGCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 8.5, cyto_nucl 8.333, cyto_mito 6.333, cyto 3
Family & Domain DBs
Amino Acid Sequences MRSSTNPPTPSRSSFTLLSFPSSFSSSISGLPSFPFLSFYFFLKSLLCSHASFPPSSPNLSFFCFLPFIFNFANPSPPCRYGSTIHPHTRRRRRFLHLYGCAGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.4
4 0.35
5 0.35
6 0.3
7 0.27
8 0.25
9 0.24
10 0.22
11 0.17
12 0.18
13 0.14
14 0.15
15 0.16
16 0.14
17 0.12
18 0.13
19 0.14
20 0.12
21 0.11
22 0.12
23 0.11
24 0.15
25 0.15
26 0.16
27 0.17
28 0.16
29 0.17
30 0.14
31 0.15
32 0.13
33 0.14
34 0.14
35 0.13
36 0.14
37 0.17
38 0.18
39 0.17
40 0.16
41 0.19
42 0.18
43 0.19
44 0.18
45 0.17
46 0.17
47 0.19
48 0.19
49 0.14
50 0.15
51 0.15
52 0.14
53 0.16
54 0.14
55 0.16
56 0.15
57 0.16
58 0.17
59 0.17
60 0.24
61 0.2
62 0.25
63 0.26
64 0.28
65 0.3
66 0.3
67 0.33
68 0.29
69 0.37
70 0.43
71 0.47
72 0.54
73 0.59
74 0.65
75 0.73
76 0.81
77 0.82
78 0.81
79 0.8
80 0.8
81 0.82
82 0.83
83 0.83
84 0.8