Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3LL16

Protein Details
Accession A0A5C3LL16    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKDKTPKKPKSKKHSVSHPPLGSTBasic
NLS Segment(s)
PositionSequence
5-13TPKKPKSKK
Subcellular Location(s) mito 13.5, nucl 10, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR026947  UBN_middle_dom  
Pfam View protein in Pfam  
PF14075  UBN_AB  
Amino Acid Sequences MKDKTPKKPKSKKHSVSHPPLGSTIKQEGTRETPIAVSDSEEQRIKHASAKAAAAGVAKAEDGEGGERAGQKRKRYITVVEGGKKRKVVDVNSFHPELQESIEEMKKTIAEESWAQKGKFPPGLKPMLAKLALKAVQLDEYDEHFFNLMPTLFPYNKFTMTKLIKRTIFQEHTALLMERQDALLRELKQLADEGFPKAEEEWEKAVVAWDKRQEKARAESGVAGGAPESISAAPTRHPTEEMEVEHASHAPGADGHDGDEGKDGKRDLHPPGKRFRMTEQMKSIVWQLVLLSNECCRLENEKNTLEGSIIQVSEQGGRKVLYQKIVAAFPEGWMSSGQISRDVSAMKKKFEKEAMEDGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.92
4 0.92
5 0.84
6 0.75
7 0.68
8 0.62
9 0.53
10 0.47
11 0.42
12 0.37
13 0.36
14 0.36
15 0.37
16 0.38
17 0.41
18 0.36
19 0.32
20 0.27
21 0.25
22 0.26
23 0.21
24 0.18
25 0.19
26 0.21
27 0.25
28 0.27
29 0.26
30 0.27
31 0.3
32 0.28
33 0.29
34 0.31
35 0.31
36 0.32
37 0.33
38 0.31
39 0.28
40 0.27
41 0.22
42 0.17
43 0.13
44 0.1
45 0.08
46 0.07
47 0.06
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.09
54 0.13
55 0.16
56 0.25
57 0.29
58 0.34
59 0.42
60 0.47
61 0.51
62 0.52
63 0.54
64 0.52
65 0.56
66 0.58
67 0.57
68 0.58
69 0.57
70 0.56
71 0.54
72 0.47
73 0.44
74 0.42
75 0.4
76 0.43
77 0.46
78 0.48
79 0.51
80 0.51
81 0.45
82 0.4
83 0.34
84 0.25
85 0.19
86 0.14
87 0.11
88 0.13
89 0.16
90 0.16
91 0.15
92 0.15
93 0.14
94 0.14
95 0.14
96 0.1
97 0.11
98 0.14
99 0.17
100 0.24
101 0.28
102 0.27
103 0.3
104 0.32
105 0.35
106 0.38
107 0.36
108 0.33
109 0.36
110 0.4
111 0.37
112 0.36
113 0.32
114 0.3
115 0.31
116 0.26
117 0.2
118 0.21
119 0.22
120 0.2
121 0.19
122 0.15
123 0.15
124 0.15
125 0.15
126 0.11
127 0.12
128 0.14
129 0.13
130 0.13
131 0.11
132 0.11
133 0.1
134 0.11
135 0.08
136 0.06
137 0.07
138 0.11
139 0.11
140 0.13
141 0.16
142 0.17
143 0.2
144 0.2
145 0.2
146 0.25
147 0.3
148 0.34
149 0.35
150 0.4
151 0.39
152 0.39
153 0.41
154 0.41
155 0.39
156 0.35
157 0.31
158 0.25
159 0.24
160 0.23
161 0.2
162 0.12
163 0.1
164 0.08
165 0.07
166 0.07
167 0.06
168 0.06
169 0.08
170 0.12
171 0.13
172 0.14
173 0.15
174 0.14
175 0.14
176 0.14
177 0.13
178 0.11
179 0.11
180 0.1
181 0.1
182 0.1
183 0.1
184 0.09
185 0.11
186 0.1
187 0.11
188 0.12
189 0.13
190 0.13
191 0.12
192 0.15
193 0.16
194 0.16
195 0.17
196 0.22
197 0.24
198 0.26
199 0.33
200 0.35
201 0.35
202 0.4
203 0.42
204 0.37
205 0.35
206 0.34
207 0.28
208 0.24
209 0.19
210 0.14
211 0.09
212 0.07
213 0.06
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.06
220 0.07
221 0.11
222 0.14
223 0.14
224 0.16
225 0.17
226 0.21
227 0.24
228 0.23
229 0.23
230 0.21
231 0.21
232 0.2
233 0.19
234 0.14
235 0.11
236 0.1
237 0.06
238 0.06
239 0.07
240 0.08
241 0.08
242 0.09
243 0.11
244 0.11
245 0.11
246 0.15
247 0.14
248 0.13
249 0.16
250 0.15
251 0.16
252 0.21
253 0.25
254 0.28
255 0.37
256 0.43
257 0.47
258 0.55
259 0.61
260 0.6
261 0.58
262 0.55
263 0.56
264 0.55
265 0.58
266 0.55
267 0.5
268 0.47
269 0.46
270 0.44
271 0.35
272 0.3
273 0.21
274 0.16
275 0.15
276 0.17
277 0.16
278 0.15
279 0.14
280 0.17
281 0.17
282 0.17
283 0.16
284 0.22
285 0.29
286 0.35
287 0.4
288 0.39
289 0.41
290 0.41
291 0.39
292 0.32
293 0.25
294 0.21
295 0.17
296 0.14
297 0.12
298 0.13
299 0.13
300 0.18
301 0.2
302 0.18
303 0.17
304 0.18
305 0.22
306 0.28
307 0.31
308 0.31
309 0.29
310 0.33
311 0.34
312 0.36
313 0.33
314 0.3
315 0.26
316 0.21
317 0.23
318 0.18
319 0.16
320 0.14
321 0.15
322 0.14
323 0.17
324 0.17
325 0.18
326 0.19
327 0.19
328 0.2
329 0.21
330 0.23
331 0.31
332 0.35
333 0.38
334 0.44
335 0.47
336 0.52
337 0.57
338 0.59
339 0.56