Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3M700

Protein Details
Accession A0A5C3M700    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MAVKIPIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-47KKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) mito 13.5, mito_nucl 12, nucl 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTNKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTAMPKIGYGSNKKTRHLLPNGLKKFLVSNIREVDLLLMHNKSFAAEVAHNVSSRNRTAIIERAKVLGIKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.9
4 0.91
5 0.9
6 0.88
7 0.87
8 0.86
9 0.83
10 0.75
11 0.66
12 0.6
13 0.56
14 0.56
15 0.56
16 0.57
17 0.52
18 0.5
19 0.5
20 0.55
21 0.59
22 0.59
23 0.59
24 0.61
25 0.7
26 0.78
27 0.83
28 0.76
29 0.74
30 0.71
31 0.67
32 0.66
33 0.61
34 0.62
35 0.63
36 0.64
37 0.56
38 0.5
39 0.44
40 0.38
41 0.35
42 0.29
43 0.29
44 0.35
45 0.37
46 0.38
47 0.41
48 0.42
49 0.45
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.36
59 0.32
60 0.31
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.19
86 0.2
87 0.2
88 0.2
89 0.18
90 0.18
91 0.21
92 0.29
93 0.33
94 0.33
95 0.33
96 0.33
97 0.32
98 0.31
99 0.29
100 0.26
101 0.2
102 0.18
103 0.21
104 0.25
105 0.26
106 0.27
107 0.31
108 0.28