Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MPC6

Protein Details
Accession A0A5C3MPC6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-37SSSGGGKSAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
10-31SSSGGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAAPSSSGGGKSAKKKKWSKGKVKDKAQHAVTLDKATFDRIIKEVPAFKFISQSILIERLKINGSLARVAIRHLEKEGQIKRIVHHSAQLIYTRATAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.33
4 0.41
5 0.46
6 0.53
7 0.62
8 0.7
9 0.77
10 0.82
11 0.83
12 0.85
13 0.89
14 0.89
15 0.91
16 0.89
17 0.84
18 0.81
19 0.72
20 0.65
21 0.55
22 0.48
23 0.39
24 0.34
25 0.28
26 0.2
27 0.19
28 0.16
29 0.16
30 0.13
31 0.13
32 0.12
33 0.12
34 0.12
35 0.13
36 0.17
37 0.15
38 0.19
39 0.18
40 0.17
41 0.18
42 0.17
43 0.19
44 0.14
45 0.14
46 0.12
47 0.16
48 0.16
49 0.15
50 0.15
51 0.14
52 0.15
53 0.15
54 0.15
55 0.11
56 0.13
57 0.13
58 0.13
59 0.13
60 0.12
61 0.13
62 0.18
63 0.17
64 0.17
65 0.18
66 0.2
67 0.21
68 0.3
69 0.34
70 0.32
71 0.35
72 0.36
73 0.36
74 0.41
75 0.42
76 0.35
77 0.35
78 0.34
79 0.32
80 0.33
81 0.34
82 0.28
83 0.25
84 0.25