Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3MFD0

Protein Details
Accession A0A5C3MFD0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-47HNNGQIKKNKKAHRNGLKKPAAHydrophilic
NLS Segment(s)
PositionSequence
32-68KKNKKAHRNGLKKPAATRTRSLKGARPFVDAKFRRNA
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSGGKIHESTSPAVEQAVPVVIAILHNNGQIKKNKKAHRNGLKKPAATRTRSLKGARPFVDAKFRRNARFALAGSNKARLEAKQAAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.12
4 0.1
5 0.07
6 0.06
7 0.06
8 0.05
9 0.06
10 0.06
11 0.07
12 0.07
13 0.08
14 0.11
15 0.13
16 0.18
17 0.25
18 0.3
19 0.38
20 0.46
21 0.52
22 0.59
23 0.67
24 0.73
25 0.76
26 0.81
27 0.79
28 0.8
29 0.78
30 0.7
31 0.64
32 0.62
33 0.58
34 0.51
35 0.48
36 0.45
37 0.44
38 0.48
39 0.47
40 0.45
41 0.46
42 0.51
43 0.47
44 0.44
45 0.42
46 0.39
47 0.48
48 0.43
49 0.41
50 0.42
51 0.45
52 0.44
53 0.45
54 0.44
55 0.38
56 0.41
57 0.38
58 0.38
59 0.37
60 0.4
61 0.39
62 0.44
63 0.39
64 0.35
65 0.36
66 0.27
67 0.31
68 0.31
69 0.31